Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3498830..3499667 | Replicon | chromosome |
| Accession | NZ_LR134226 | ||
| Organism | Escherichia coli strain NCTC9088 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | EL094_RS17155 | Protein ID | WP_000227784.1 |
| Coordinates | 3499125..3499667 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | EL094_RS17150 | Protein ID | WP_001297137.1 |
| Coordinates | 3498830..3499141 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL094_RS17125 | 3493850..3494797 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| EL094_RS17130 | 3494819..3496810 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| EL094_RS17135 | 3496800..3497414 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| EL094_RS17140 | 3497414..3497743 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| EL094_RS17145 | 3497755..3498645 | + | 891 | WP_000971336.1 | heme o synthase | - |
| EL094_RS17150 | 3498830..3499141 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| EL094_RS17155 | 3499125..3499667 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| EL094_RS17160 | 3499723..3500658 | - | 936 | WP_001368479.1 | sel1 repeat family protein | - |
| EL094_RS17165 | 3501066..3502430 | + | 1365 | WP_001000960.1 | MFS transporter | - |
| EL094_RS17170 | 3502558..3503049 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| EL094_RS17175 | 3503217..3504128 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T287158 WP_000227784.1 NZ_LR134226:3499125-3499667 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|