Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 4639855..4640498 Replicon chromosome
Accession NZ_LR134222
Organism Escherichia coli strain NCTC11129

Toxin (Protein)


Gene name vagD Uniprot ID A0A6N9SI53
Locus tag EL113_RS22810 Protein ID WP_032192044.1
Coordinates 4640082..4640498 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag EL113_RS22805 Protein ID WP_001261283.1
Coordinates 4639855..4640085 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL113_RS22765 4635478..4637229 - 1752 WP_001556710.1 arsenite efflux transporter ATPase subunit ArsA -
EL113_RS22770 4637247..4637609 - 363 WP_000783215.1 arsenite efflux transporter metallochaperone ArsD -
EL113_RS22775 4637657..4638010 - 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
EL113_RS22780 4638285..4638560 - 276 Protein_4380 hypothetical protein -
EL113_RS22785 4638730..4639035 - 306 WP_016240353.1 type II toxin-antitoxin system toxin CcdB -
EL113_RS22790 4639037..4639255 - 219 WP_016240352.1 type II toxin-antitoxin system antitoxin CcdA -
EL113_RS22805 4639855..4640085 + 231 WP_001261283.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EL113_RS22810 4640082..4640498 + 417 WP_032192044.1 type II toxin-antitoxin system VapC family toxin Toxin
EL113_RS22815 4640534..4640785 + 252 WP_105966327.1 hypothetical protein -
EL113_RS22820 4640866..4641966 - 1101 WP_032192045.1 NADH:flavin oxidoreductase/NADH oxidase -
EL113_RS22830 4643288..4644631 - 1344 WP_032192047.1 APC family permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15113.64 Da        Isoelectric Point: 7.7809

>T287144 WP_032192044.1 NZ_LR134222:4640082-4640498 [Escherichia coli]
MKKTYMLDTCICSFIMREQPEAVLTRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATIEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT287144 WP_001261283.1 NZ_LR134222:4639855-4640085 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6N9SI53

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References