Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4638730..4639255 | Replicon | chromosome |
| Accession | NZ_LR134222 | ||
| Organism | Escherichia coli strain NCTC11129 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | EL113_RS22785 | Protein ID | WP_016240353.1 |
| Coordinates | 4638730..4639035 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A8H9ZZC6 |
| Locus tag | EL113_RS22790 | Protein ID | WP_016240352.1 |
| Coordinates | 4639037..4639255 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL113_RS22760 | 4634140..4635429 | - | 1290 | WP_003026002.1 | arsenite efflux transporter membrane subunit ArsB | - |
| EL113_RS22765 | 4635478..4637229 | - | 1752 | WP_001556710.1 | arsenite efflux transporter ATPase subunit ArsA | - |
| EL113_RS22770 | 4637247..4637609 | - | 363 | WP_000783215.1 | arsenite efflux transporter metallochaperone ArsD | - |
| EL113_RS22775 | 4637657..4638010 | - | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| EL113_RS22780 | 4638285..4638560 | - | 276 | Protein_4380 | hypothetical protein | - |
| EL113_RS22785 | 4638730..4639035 | - | 306 | WP_016240353.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| EL113_RS22790 | 4639037..4639255 | - | 219 | WP_016240352.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| EL113_RS22805 | 4639855..4640085 | + | 231 | WP_001261283.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| EL113_RS22810 | 4640082..4640498 | + | 417 | WP_032192044.1 | type II toxin-antitoxin system VapC family toxin | - |
| EL113_RS22815 | 4640534..4640785 | + | 252 | WP_105966327.1 | hypothetical protein | - |
| EL113_RS22820 | 4640866..4641966 | - | 1101 | WP_032192045.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11518.20 Da Isoelectric Point: 5.6752
>T287143 WP_016240353.1 NZ_LR134222:c4639035-4638730 [Escherichia coli]
MQFKVYAYKRESCYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRDLYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESCYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRDLYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|