Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 4604765..4605366 | Replicon | chromosome |
| Accession | NZ_LR134222 | ||
| Organism | Escherichia coli strain NCTC11129 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | Q47172 |
| Locus tag | EL113_RS22585 | Protein ID | WP_001694510.1 |
| Coordinates | 4604765..4605145 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | EL113_RS22590 | Protein ID | WP_001190712.1 |
| Coordinates | 4605145..4605366 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL113_RS22550 | 4599880..4600577 | + | 698 | Protein_4337 | IS1 family transposase | - |
| EL113_RS22555 | 4600672..4601109 | + | 438 | WP_024195570.1 | GyrI-like domain-containing protein | - |
| EL113_RS24970 | 4601350..4601853 | - | 504 | WP_063615128.1 | hypothetical protein | - |
| EL113_RS22565 | 4602369..4602578 | + | 210 | WP_021553350.1 | helix-turn-helix domain-containing protein | - |
| EL113_RS22570 | 4602669..4603366 | - | 698 | Protein_4341 | IS1 family transposase | - |
| EL113_RS22575 | 4603510..4604553 | - | 1044 | WP_000648832.1 | DUF968 domain-containing protein | - |
| EL113_RS22580 | 4604581..4604760 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| EL113_RS22585 | 4604765..4605145 | - | 381 | WP_001694510.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| EL113_RS22590 | 4605145..4605366 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EL113_RS22595 | 4605549..4607105 | + | 1557 | WP_021553349.1 | type I restriction-modification system subunit M | - |
| EL113_RS22600 | 4607102..4608313 | + | 1212 | WP_023157127.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4594234..4629812 | 35578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13616.35 Da Isoelectric Point: 5.1514
>T287142 WP_001694510.1 NZ_LR134222:c4605145-4604765 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A737M8C8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |