Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 4604765..4605366 Replicon chromosome
Accession NZ_LR134222
Organism Escherichia coli strain NCTC11129

Toxin (Protein)


Gene name doc Uniprot ID Q47172
Locus tag EL113_RS22585 Protein ID WP_001694510.1
Coordinates 4604765..4605145 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag EL113_RS22590 Protein ID WP_001190712.1
Coordinates 4605145..4605366 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL113_RS22550 4599880..4600577 + 698 Protein_4337 IS1 family transposase -
EL113_RS22555 4600672..4601109 + 438 WP_024195570.1 GyrI-like domain-containing protein -
EL113_RS24970 4601350..4601853 - 504 WP_063615128.1 hypothetical protein -
EL113_RS22565 4602369..4602578 + 210 WP_021553350.1 helix-turn-helix domain-containing protein -
EL113_RS22570 4602669..4603366 - 698 Protein_4341 IS1 family transposase -
EL113_RS22575 4603510..4604553 - 1044 WP_000648832.1 DUF968 domain-containing protein -
EL113_RS22580 4604581..4604760 - 180 WP_000113018.1 hypothetical protein -
EL113_RS22585 4604765..4605145 - 381 WP_001694510.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL113_RS22590 4605145..4605366 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL113_RS22595 4605549..4607105 + 1557 WP_021553349.1 type I restriction-modification system subunit M -
EL113_RS22600 4607102..4608313 + 1212 WP_023157127.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4594234..4629812 35578


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13616.35 Da        Isoelectric Point: 5.1514

>T287142 WP_001694510.1 NZ_LR134222:c4605145-4604765 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT287142 WP_001190712.1 NZ_LR134222:c4605366-4605145 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A737M8C8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References