Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4123075..4123873 | Replicon | chromosome |
| Accession | NZ_LR134222 | ||
| Organism | Escherichia coli strain NCTC11129 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | EL113_RS20195 | Protein ID | WP_000854919.1 |
| Coordinates | 4123075..4123452 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2G4AEZ5 |
| Locus tag | EL113_RS20200 | Protein ID | WP_001285608.1 |
| Coordinates | 4123499..4123873 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL113_RS20145 | 4118120..4118302 | - | 183 | WP_000500669.1 | hypothetical protein | - |
| EL113_RS20150 | 4118367..4118850 | + | 484 | Protein_3889 | M48 family metallopeptidase | - |
| EL113_RS20155 | 4118896..4120377 | - | 1482 | WP_001293292.1 | N-6 DNA methylase | - |
| EL113_RS20160 | 4120370..4120972 | - | 603 | WP_000276816.1 | restriction endonuclease subunit S | - |
| EL113_RS20165 | 4120989..4121174 | - | 186 | WP_001003201.1 | hypothetical protein | - |
| EL113_RS20170 | 4121450..4121677 | - | 228 | Protein_3893 | integrase arm-type DNA-binding domain-containing protein | - |
| EL113_RS24815 | 4122142..4122288 | - | 147 | WP_001290177.1 | hypothetical protein | - |
| EL113_RS20185 | 4122373..4122570 | - | 198 | WP_001403937.1 | DUF957 domain-containing protein | - |
| EL113_RS20190 | 4122590..4123078 | - | 489 | WP_000777665.1 | hypothetical protein | - |
| EL113_RS20195 | 4123075..4123452 | - | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| EL113_RS20200 | 4123499..4123873 | - | 375 | WP_001285608.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| EL113_RS20205 | 4123953..4124174 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| EL113_RS20210 | 4124261..4124737 | - | 477 | WP_001186188.1 | RadC family protein | - |
| EL113_RS20215 | 4124752..4125231 | - | 480 | WP_000706980.1 | antirestriction protein | - |
| EL113_RS20220 | 4125497..4126315 | - | 819 | WP_001175165.1 | DUF945 domain-containing protein | - |
| EL113_RS20225 | 4126405..4126638 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| EL113_RS20230 | 4126644..4127321 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| EL113_RS20235 | 4127469..4128149 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4116061..4138100 | 22039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T287138 WP_000854919.1 NZ_LR134222:c4123452-4123075 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13610.37 Da Isoelectric Point: 5.5051
>AT287138 WP_001285608.1 NZ_LR134222:c4123873-4123499 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X1M0U2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4AEZ5 |