Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4123075..4123873 Replicon chromosome
Accession NZ_LR134222
Organism Escherichia coli strain NCTC11129

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag EL113_RS20195 Protein ID WP_000854919.1
Coordinates 4123075..4123452 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag EL113_RS20200 Protein ID WP_001285608.1
Coordinates 4123499..4123873 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL113_RS20145 4118120..4118302 - 183 WP_000500669.1 hypothetical protein -
EL113_RS20150 4118367..4118850 + 484 Protein_3889 M48 family metallopeptidase -
EL113_RS20155 4118896..4120377 - 1482 WP_001293292.1 N-6 DNA methylase -
EL113_RS20160 4120370..4120972 - 603 WP_000276816.1 restriction endonuclease subunit S -
EL113_RS20165 4120989..4121174 - 186 WP_001003201.1 hypothetical protein -
EL113_RS20170 4121450..4121677 - 228 Protein_3893 integrase arm-type DNA-binding domain-containing protein -
EL113_RS24815 4122142..4122288 - 147 WP_001290177.1 hypothetical protein -
EL113_RS20185 4122373..4122570 - 198 WP_001403937.1 DUF957 domain-containing protein -
EL113_RS20190 4122590..4123078 - 489 WP_000777665.1 hypothetical protein -
EL113_RS20195 4123075..4123452 - 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
EL113_RS20200 4123499..4123873 - 375 WP_001285608.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
EL113_RS20205 4123953..4124174 - 222 WP_000692350.1 DUF987 domain-containing protein -
EL113_RS20210 4124261..4124737 - 477 WP_001186188.1 RadC family protein -
EL113_RS20215 4124752..4125231 - 480 WP_000706980.1 antirestriction protein -
EL113_RS20220 4125497..4126315 - 819 WP_001175165.1 DUF945 domain-containing protein -
EL113_RS20225 4126405..4126638 - 234 WP_001278293.1 DUF905 family protein -
EL113_RS20230 4126644..4127321 - 678 WP_001097301.1 hypothetical protein -
EL113_RS20235 4127469..4128149 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4116061..4138100 22039


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T287138 WP_000854919.1 NZ_LR134222:c4123452-4123075 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT287138 WP_001285608.1 NZ_LR134222:c4123873-4123499 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References