Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2460160..2460798 | Replicon | chromosome |
| Accession | NZ_LR134222 | ||
| Organism | Escherichia coli strain NCTC11129 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | EL113_RS12140 | Protein ID | WP_000813794.1 |
| Coordinates | 2460622..2460798 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL113_RS12135 | Protein ID | WP_001270286.1 |
| Coordinates | 2460160..2460576 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL113_RS12115 | 2455312..2456253 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| EL113_RS12120 | 2456254..2457267 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| EL113_RS12125 | 2457285..2458430 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| EL113_RS12130 | 2458675..2460081 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| EL113_RS12135 | 2460160..2460576 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EL113_RS12140 | 2460622..2460798 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EL113_RS12145 | 2461020..2461250 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| EL113_RS12150 | 2461342..2463303 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EL113_RS12155 | 2463376..2463912 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| EL113_RS12160 | 2463965..2465179 | + | 1215 | WP_001349372.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2465219..2466484 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287133 WP_000813794.1 NZ_LR134222:c2460798-2460622 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287133 WP_001270286.1 NZ_LR134222:c2460576-2460160 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|