Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3678783..3679462 Replicon chromosome
Accession NZ_LR134220
Organism Escherichia coli strain NCTC11121

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag EL088_RS18075 Protein ID WP_000854680.1
Coordinates 3679121..3679462 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag EL088_RS18070 Protein ID WP_000070396.1
Coordinates 3678783..3679100 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL088_RS18025 3674221..3675042 + 822 WP_000197387.1 DUF945 domain-containing protein -
EL088_RS18030 3675259..3675960 + 702 WP_111724748.1 WYL domain-containing protein -
EL088_RS18035 3676001..3676237 + 237 WP_001144031.1 hypothetical protein -
EL088_RS18040 3676237..3676680 + 444 WP_000649865.1 hypothetical protein -
EL088_RS18045 3676703..3677170 + 468 WP_001385283.1 hypothetical protein -
EL088_RS18050 3677247..3677486 + 240 WP_000194654.1 DUF905 domain-containing protein -
EL088_RS18055 3677584..3678042 + 459 WP_000211838.1 antirestriction protein -
EL088_RS18060 3678058..3678534 + 477 WP_000811693.1 RadC family protein -
EL088_RS18065 3678543..3678764 + 222 WP_001568590.1 DUF987 domain-containing protein -
EL088_RS18070 3678783..3679100 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
EL088_RS18075 3679121..3679462 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
EL088_RS18080 3680040..3681104 - 1065 Protein_3518 phosphoribosyl transferase -
EL088_RS18090 3682363..3682530 - 168 Protein_3520 phosphoribosyl transferase -
EL088_RS18095 3682541..3683521 - 981 WP_001567470.1 DNA-protecting protein DprA -
EL088_RS18100 3683937..3684209 - 273 WP_001185343.1 ogr/Delta-like zinc finger family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3674221..3693342 19121


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T287118 WP_000854680.1 NZ_LR134220:3679121-3679462 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT287118 WP_000070396.1 NZ_LR134220:3678783-3679100 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References