Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1147037..1147704 | Replicon | chromosome |
| Accession | NZ_LR134220 | ||
| Organism | Escherichia coli strain NCTC11121 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A156PNF2 |
| Locus tag | EL088_RS05560 | Protein ID | WP_001618791.1 |
| Coordinates | 1147037..1147366 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A156PNH9 |
| Locus tag | EL088_RS05565 | Protein ID | WP_001618790.1 |
| Coordinates | 1147387..1147704 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL088_RS05555 | 1142093..1146673 | + | 4581 | WP_111724795.1 | adhesin-like autotransporter YpjA/EhaD | - |
| EL088_RS05560 | 1147037..1147366 | - | 330 | WP_001618791.1 | TA system toxin CbtA family protein | Toxin |
| EL088_RS05565 | 1147387..1147704 | - | 318 | WP_001618790.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL088_RS05570 | 1147723..1147944 | - | 222 | WP_044864853.1 | DUF987 domain-containing protein | - |
| EL088_RS05575 | 1147953..1148429 | - | 477 | WP_000811693.1 | RadC family protein | - |
| EL088_RS05580 | 1148445..1148903 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| EL088_RS05585 | 1149001..1149240 | - | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| EL088_RS05590 | 1149317..1149784 | - | 468 | WP_001547765.1 | hypothetical protein | - |
| EL088_RS05595 | 1149807..1150250 | - | 444 | WP_032199444.1 | hypothetical protein | - |
| EL088_RS05600 | 1150250..1150486 | - | 237 | WP_001144031.1 | hypothetical protein | - |
| EL088_RS05605 | 1150527..1151228 | - | 702 | WP_111724571.1 | WYL domain-containing protein | - |
| EL088_RS05610 | 1151445..1152266 | - | 822 | WP_111724572.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1138092..1178925 | 40833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12509.43 Da Isoelectric Point: 7.2767
>T287110 WP_001618791.1 NZ_LR134220:c1147366-1147037 [Escherichia coli]
MNTLPATTQRAAKPCLSPVAVWKMLLTHLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADTVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTDLLKTNVK
MNTLPATTQRAAKPCLSPVAVWKMLLTHLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADTVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTDLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A156PNF2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A156PNH9 |