Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3985224..3986056 | Replicon | chromosome |
| Accession | NZ_LR134216 | ||
| Organism | Escherichia coli strain NCTC10973 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | EL103_RS19325 | Protein ID | WP_000854753.1 |
| Coordinates | 3985224..3985598 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL103_RS19330 | Protein ID | WP_021542768.1 |
| Coordinates | 3985688..3986056 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL103_RS19280 | 3980439..3981545 | + | 1107 | WP_001353974.1 | N-acetylneuraminate epimerase | - |
| EL103_RS19285 | 3981610..3982590 | + | 981 | WP_021542769.1 | transposase | - |
| EL103_RS19290 | 3982598..3983248 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| EL103_RS22605 | 3984293..3984445 | - | 153 | WP_001280445.1 | hypothetical protein | - |
| EL103_RS19315 | 3984530..3984727 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| EL103_RS19320 | 3984739..3985227 | - | 489 | WP_000777547.1 | hypothetical protein | - |
| EL103_RS19325 | 3985224..3985598 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| EL103_RS19330 | 3985688..3986056 | - | 369 | WP_021542768.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL103_RS19335 | 3986219..3986440 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL103_RS19340 | 3986503..3986979 | - | 477 | WP_001186774.1 | RadC family protein | - |
| EL103_RS19345 | 3986995..3987480 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| EL103_RS19350 | 3987535..3988353 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
| EL103_RS19360 | 3988453..3988686 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| EL103_RS19365 | 3988765..3989220 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T287103 WP_000854753.1 NZ_LR134216:c3985598-3985224 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13573.33 Da Isoelectric Point: 6.4789
>AT287103 WP_021542768.1 NZ_LR134216:c3986056-3985688 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWRLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWRLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|