Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2951077..2951700 | Replicon | chromosome |
Accession | NZ_LR134215 | ||
Organism | Shimwellia blattae strain NCTC12127 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | I2BBN0 |
Locus tag | EL083_RS14215 | Protein ID | WP_002438965.1 |
Coordinates | 2951482..2951700 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | I2BBM9 |
Locus tag | EL083_RS14210 | Protein ID | WP_002438967.1 |
Coordinates | 2951077..2951457 (+) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL083_RS14200 | 2946195..2947370 | + | 1176 | WP_002438970.1 | efflux RND transporter periplasmic adaptor subunit | - |
EL083_RS14205 | 2947393..2950548 | + | 3156 | WP_002438968.1 | multidrug efflux RND transporter permease subunit | - |
EL083_RS14210 | 2951077..2951457 | + | 381 | WP_002438967.1 | Hha toxicity modulator TomB | Antitoxin |
EL083_RS14215 | 2951482..2951700 | + | 219 | WP_002438965.1 | hemolysin expression modulator Hha | Toxin |
EL083_RS14220 | 2952093..2952566 | + | 474 | WP_002438964.1 | YlaC family protein | - |
EL083_RS14230 | 2952775..2953209 | + | 435 | WP_164558553.1 | MGMT family protein | - |
EL083_RS14235 | 2953261..2953791 | - | 531 | WP_002438961.1 | YbaY family lipoprotein | - |
EL083_RS14240 | 2953999..2954862 | + | 864 | WP_002438960.1 | acyl-CoA thioesterase II | - |
EL083_RS14245 | 2954911..2956191 | - | 1281 | WP_002438958.1 | ammonium transporter AmtB | - |
EL083_RS14250 | 2956222..2956560 | - | 339 | WP_002438956.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8600.97 Da Isoelectric Point: 8.9008
>T287085 WP_002438965.1 NZ_LR134215:2951482-2951700 [Shimwellia blattae]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDTELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDTELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14653.43 Da Isoelectric Point: 4.7334
>AT287085 WP_002438967.1 NZ_LR134215:2951077-2951457 [Shimwellia blattae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLGETNRGWVNDPTSAINLQLNDLIEHIATFALNYKIKYDDDSKLIEQIDEYL
DDTFTLFSNYGIDAKDLQKWQKSGNRLFRCFVNASRANPVSLSLEK
MDEYSPKRHDIAQLRFLCETLYHDCLANLGETNRGWVNDPTSAINLQLNDLIEHIATFALNYKIKYDDDSKLIEQIDEYL
DDTFTLFSNYGIDAKDLQKWQKSGNRLFRCFVNASRANPVSLSLEK
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|