Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 2183153..2183704 | Replicon | chromosome |
| Accession | NZ_LR134215 | ||
| Organism | Shimwellia blattae strain NCTC12127 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | I2B9K3 |
| Locus tag | EL083_RS10450 | Protein ID | WP_002443590.1 |
| Coordinates | 2183153..2183470 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | I2B9K4 |
| Locus tag | EL083_RS10455 | Protein ID | WP_002443589.1 |
| Coordinates | 2183474..2183704 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL083_RS10415 | 2178342..2178554 | - | 213 | WP_002443597.1 | hypothetical protein | - |
| EL083_RS10420 | 2178655..2179269 | - | 615 | WP_002443596.1 | membrane integrity-associated transporter subunit PqiC | - |
| EL083_RS10425 | 2179266..2180174 | - | 909 | WP_002443595.1 | MCE family protein | - |
| EL083_RS10430 | 2180176..2180949 | - | 774 | WP_002443594.1 | ATP-binding cassette domain-containing protein | - |
| EL083_RS10435 | 2180952..2182079 | - | 1128 | WP_002443593.1 | ABC transporter permease | - |
| EL083_RS10440 | 2182290..2182580 | + | 291 | WP_002443592.1 | hypothetical protein | - |
| EL083_RS10445 | 2182623..2182868 | - | 246 | WP_002443591.1 | YfdY family protein | - |
| EL083_RS10450 | 2183153..2183470 | - | 318 | WP_002443590.1 | CcdB family protein | Toxin |
| EL083_RS10455 | 2183474..2183704 | - | 231 | WP_002443589.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| EL083_RS10460 | 2183888..2184526 | - | 639 | WP_002443588.1 | leucine efflux protein LeuE | - |
| EL083_RS10465 | 2184698..2185228 | - | 531 | WP_002443587.1 | cytochrome b561 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11725.67 Da Isoelectric Point: 5.0491
>T287084 WP_002443590.1 NZ_LR134215:c2183470-2183153 [Shimwellia blattae]
MQFTIYRNPGRSSLYPLLIDVTSDIIGALNTRIVIPLLPVERYPNPEVRPVRLNPVLELIDGKQYALMTHELASIPLKAL
GAEFCDGSEYRQTVKGALDFILDGI
MQFTIYRNPGRSSLYPLLIDVTSDIIGALNTRIVIPLLPVERYPNPEVRPVRLNPVLELIDGKQYALMTHELASIPLKAL
GAEFCDGSEYRQTVKGALDFILDGI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|