Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2145173..2145808 | Replicon | chromosome |
| Accession | NZ_LR134215 | ||
| Organism | Shimwellia blattae strain NCTC12127 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL083_RS10230 | Protein ID | WP_071840850.1 |
| Coordinates | 2145173..2145355 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | I2B9F6 |
| Locus tag | EL083_RS10235 | Protein ID | WP_002440805.1 |
| Coordinates | 2145395..2145808 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL083_RS10195 | 2141787..2142248 | - | 462 | WP_002440814.1 | phage terminase small subunit P27 family | - |
| EL083_RS10200 | 2142363..2142716 | - | 354 | WP_002440812.1 | HNH endonuclease | - |
| EL083_RS10205 | 2142713..2143141 | - | 429 | WP_002440811.1 | hypothetical protein | - |
| EL083_RS10210 | 2143145..2143417 | - | 273 | WP_002440809.1 | hypothetical protein | - |
| EL083_RS10215 | 2143534..2144004 | - | 471 | WP_014716030.1 | lysis protein | - |
| EL083_RS10220 | 2144013..2144645 | - | 633 | WP_002440807.1 | glycoside hydrolase family 19 protein | - |
| EL083_RS10225 | 2144649..2144987 | - | 339 | WP_002440806.1 | phage holin, lambda family | - |
| EL083_RS10230 | 2145173..2145355 | + | 183 | WP_071840850.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL083_RS10235 | 2145395..2145808 | + | 414 | WP_002440805.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL083_RS10240 | 2145895..2146341 | + | 447 | WP_002440804.1 | hypothetical protein | - |
| EL083_RS10250 | 2146841..2147026 | - | 186 | WP_014716031.1 | site-specific DNA-methyltransferase | - |
| EL083_RS10255 | 2147152..2148239 | + | 1088 | WP_126298247.1 | IS3 family transposase | - |
| EL083_RS10260 | 2148242..2149096 | - | 855 | WP_014716032.1 | site-specific DNA-methyltransferase | - |
| EL083_RS10265 | 2149508..2150077 | - | 570 | WP_002443626.1 | DUF1133 family protein | - |
| EL083_RS10270 | 2150061..2150219 | - | 159 | WP_014716034.1 | YlcG family protein | - |
| EL083_RS10275 | 2150176..2150574 | - | 399 | WP_002443625.1 | RusA family crossover junction endodeoxyribonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2114814..2180949 | 66135 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6868.11 Da Isoelectric Point: 11.0007
>T287083 WP_071840850.1 NZ_LR134215:2145173-2145355 [Shimwellia blattae]
MKSSELISLLEKNGWVLERIKGSHHQFSHPDFAIVITVPHPRKDVKPGTLRQILKNAKLK
MKSSELISLLEKNGWVLERIKGSHHQFSHPDFAIVITVPHPRKDVKPGTLRQILKNAKLK
Download Length: 183 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15229.08 Da Isoelectric Point: 4.8087
>AT287083 WP_002440805.1 NZ_LR134215:2145395-2145808 [Shimwellia blattae]
MLYPAFVEVDKDGTASGWFPDVPGCLFAGDNMEAAFADARSAIDAHFELLSEKDLPIPGAHPMEEHVVNDPGTYTGGRWL
YVDVNMDKFDGRAERINITLPHRLLERIDSTVKHKPEYGSRSAFLAVAARNELHKSD
MLYPAFVEVDKDGTASGWFPDVPGCLFAGDNMEAAFADARSAIDAHFELLSEKDLPIPGAHPMEEHVVNDPGTYTGGRWL
YVDVNMDKFDGRAERINITLPHRLLERIDSTVKHKPEYGSRSAFLAVAARNELHKSD
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|