Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1598883..1599473 | Replicon | chromosome |
Accession | NZ_LR134215 | ||
Organism | Shimwellia blattae strain NCTC12127 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | I2B7X3 |
Locus tag | EL083_RS07525 | Protein ID | WP_002440075.1 |
Coordinates | 1599141..1599473 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | I2B7X2 |
Locus tag | EL083_RS07520 | Protein ID | WP_002440074.1 |
Coordinates | 1598883..1599140 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL083_RS07495 | 1594068..1595516 | - | 1449 | WP_002440068.1 | AMP nucleosidase | - |
EL083_RS07505 | 1596651..1597568 | + | 918 | WP_002440070.1 | nitrogen assimilation transcriptional regulator NAC | - |
EL083_RS07510 | 1597674..1598624 | + | 951 | WP_002440072.1 | HTH-type transcriptional regulator Cbl | - |
EL083_RS07520 | 1598883..1599140 | + | 258 | WP_002440074.1 | hypothetical protein | Antitoxin |
EL083_RS07525 | 1599141..1599473 | + | 333 | WP_002440075.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL083_RS07535 | 1599715..1600500 | - | 786 | WP_002440077.1 | DgsA anti-repressor MtfA | - |
EL083_RS07545 | 1600857..1601495 | + | 639 | WP_002440078.1 | GrpB family protein | - |
EL083_RS07550 | 1601641..1601904 | + | 264 | WP_034920043.1 | hypothetical protein | - |
EL083_RS07555 | 1602077..1603513 | + | 1437 | WP_174270544.1 | DNA cytosine methyltransferase | - |
EL083_RS07560 | 1603497..1603970 | + | 474 | WP_002440083.1 | DNA mismatch endonuclease Vsr | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11760.52 Da Isoelectric Point: 10.2965
>T287077 WP_002440075.1 NZ_LR134215:1599141-1599473 [Shimwellia blattae]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGNFARTAGFAVSLDGAGTKTTGVIRCDQPRTI
DMAARNGKRLERLPDAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGNFARTAGFAVSLDGAGTKTTGVIRCDQPRTI
DMAARNGKRLERLPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|