Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 704581..705244 | Replicon | chromosome |
Accession | NZ_LR134215 | ||
Organism | Shimwellia blattae strain NCTC12127 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | EL083_RS03375 | Protein ID | WP_002444974.1 |
Coordinates | 704828..705244 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | I2B5K8 |
Locus tag | EL083_RS03370 | Protein ID | WP_002444972.1 |
Coordinates | 704581..704847 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL083_RS03350 | 700413..701000 | + | 588 | WP_002444964.1 | HD domain-containing protein | - |
EL083_RS03355 | 701039..701767 | + | 729 | WP_014715822.1 | MurR/RpiR family transcriptional regulator | - |
EL083_RS03360 | 701903..703336 | + | 1434 | WP_002444968.1 | 6-phospho-beta-glucosidase | - |
EL083_RS03365 | 703369..704358 | - | 990 | WP_002444970.1 | tRNA-modifying protein YgfZ | - |
EL083_RS03370 | 704581..704847 | + | 267 | WP_002444972.1 | FAD assembly factor SdhE | Antitoxin |
EL083_RS03375 | 704828..705244 | + | 417 | WP_002444974.1 | hypothetical protein | Toxin |
EL083_RS03380 | 705259..705780 | - | 522 | WP_002444975.1 | flavodoxin FldB | - |
EL083_RS03385 | 705881..706801 | + | 921 | WP_002444977.1 | site-specific tyrosine recombinase XerD | - |
EL083_RS03390 | 706831..707547 | + | 717 | WP_002444979.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL083_RS03395 | 707551..709284 | + | 1734 | WP_002444982.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16236.11 Da Isoelectric Point: 11.2011
>T287075 WP_002444974.1 NZ_LR134215:704828-705244 [Shimwellia blattae]
VVLWQSELRVSWRAQWLSLLLHGIVAAVVLLLPWPLNYLPVWLLLLSLVVLDCVRSQRRINARHGEIKLLDNSQLHWLGR
DWLILGTPWMSRAGMLLRLRDTTTARRHLLWVASDSVDQGEWRDLRRVLAEQKYQPPH
VVLWQSELRVSWRAQWLSLLLHGIVAAVVLLLPWPLNYLPVWLLLLSLVVLDCVRSQRRINARHGEIKLLDNSQLHWLGR
DWLILGTPWMSRAGMLLRLRDTTTARRHLLWVASDSVDQGEWRDLRRVLAEQKYQPPH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|