Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3520524..3521144 | Replicon | chromosome |
Accession | NZ_LR134214 | ||
Organism | Citrobacter portucalensis strain NCTC11104 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | EL073_RS17410 | Protein ID | WP_002892050.1 |
Coordinates | 3520926..3521144 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | EL073_RS17405 | Protein ID | WP_003021733.1 |
Coordinates | 3520524..3520898 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL073_RS17395 | 3515670..3516863 | + | 1194 | WP_126319001.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
EL073_RS17400 | 3516886..3520035 | + | 3150 | WP_126319003.1 | efflux RND transporter permease AcrB | - |
EL073_RS17405 | 3520524..3520898 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
EL073_RS17410 | 3520926..3521144 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
EL073_RS17415 | 3521326..3521877 | + | 552 | WP_003835924.1 | maltose O-acetyltransferase | - |
EL073_RS17420 | 3521994..3522464 | + | 471 | WP_126319005.1 | hypothetical protein | - |
EL073_RS17425 | 3522543..3522683 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
EL073_RS17430 | 3522685..3522945 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
EL073_RS17435 | 3523134..3524687 | + | 1554 | WP_126319006.1 | EAL domain-containing protein | - |
EL073_RS17440 | 3524739..3525092 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
EL073_RS17445 | 3525157..3525786 | - | 630 | WP_126319008.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287067 WP_002892050.1 NZ_LR134214:3520926-3521144 [Citrobacter portucalensis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT287067 WP_003021733.1 NZ_LR134214:3520524-3520898 [Citrobacter portucalensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |