Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2400634..2401370 | Replicon | chromosome |
| Accession | NZ_LR134214 | ||
| Organism | Citrobacter portucalensis strain NCTC11104 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | EL073_RS11885 | Protein ID | WP_126318108.1 |
| Coordinates | 2400888..2401370 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | EL073_RS11880 | Protein ID | WP_008784769.1 |
| Coordinates | 2400634..2400900 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL073_RS11860 | 2395899..2396528 | + | 630 | WP_003832974.1 | winged helix-turn-helix transcriptional regulator | - |
| EL073_RS11865 | 2396645..2397031 | - | 387 | WP_063941972.1 | hypothetical protein | - |
| EL073_RS11875 | 2398497..2400480 | + | 1984 | Protein_2274 | MBL fold metallo-hydrolase | - |
| EL073_RS11880 | 2400634..2400900 | + | 267 | WP_008784769.1 | DUF1778 domain-containing protein | Antitoxin |
| EL073_RS11885 | 2400888..2401370 | + | 483 | WP_126318108.1 | GNAT family N-acetyltransferase | Toxin |
| EL073_RS23100 | 2401624..2401791 | - | 168 | Protein_2277 | glyceraldehyde-3-phosphate dehydrogenase | - |
| EL073_RS11890 | 2401777..2402960 | - | 1184 | Protein_2278 | mechanosensitive ion channel family protein | - |
| EL073_RS11895 | 2403340..2403717 | + | 378 | WP_003832962.1 | hypothetical protein | - |
| EL073_RS11900 | 2403771..2404606 | + | 836 | Protein_2280 | DMT family transporter | - |
| EL073_RS11905 | 2404616..2405137 | - | 522 | WP_126319810.1 | GNAT family N-acetyltransferase | - |
| EL073_RS11910 | 2405248..2406006 | + | 759 | WP_126318110.1 | trans-aconitate 2-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2395497..2405137 | 9640 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17655.49 Da Isoelectric Point: 9.8994
>T287066 WP_126318108.1 NZ_LR134214:2400888-2401370 [Citrobacter portucalensis]
VGFVTAPEPLTHIHRLAEFVSGEIILDDWLKQKGLKNQALGAARTFVVCKTDTRQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSVRGKGLGADLLHDAVLRCYKVAENIGVRAVMVHALTDEAKRFYLHHGFKASQLQERTLFLRLS
VGFVTAPEPLTHIHRLAEFVSGEIILDDWLKQKGLKNQALGAARTFVVCKTDTRQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSVRGKGLGADLLHDAVLRCYKVAENIGVRAVMVHALTDEAKRFYLHHGFKASQLQERTLFLRLS
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|