Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 825018..825672 | Replicon | chromosome |
Accession | NZ_LR134214 | ||
Organism | Citrobacter portucalensis strain NCTC11104 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | EL073_RS04170 | Protein ID | WP_003825515.1 |
Coordinates | 825265..825672 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | EL073_RS04165 | Protein ID | WP_003825514.1 |
Coordinates | 825018..825284 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL073_RS04135 | 820173..821606 | - | 1434 | WP_126317438.1 | 6-phospho-beta-glucosidase BglA | - |
EL073_RS04140 | 821727..822455 | - | 729 | WP_126319758.1 | MurR/RpiR family transcriptional regulator | - |
EL073_RS04145 | 822508..822819 | + | 312 | WP_048225466.1 | N(4)-acetylcytidine aminohydrolase | - |
EL073_RS04150 | 822983..823645 | + | 663 | WP_126317439.1 | hemolysin III family protein | - |
EL073_RS04155 | 823777..824760 | - | 984 | WP_126317440.1 | tRNA-modifying protein YgfZ | - |
EL073_RS04165 | 825018..825284 | + | 267 | WP_003825514.1 | FAD assembly factor SdhE | Antitoxin |
EL073_RS04170 | 825265..825672 | + | 408 | WP_003825515.1 | protein YgfX | Toxin |
EL073_RS04175 | 825774..826295 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
EL073_RS04180 | 826409..827305 | + | 897 | WP_126317441.1 | site-specific tyrosine recombinase XerD | - |
EL073_RS04185 | 827329..828042 | + | 714 | WP_126317442.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL073_RS04190 | 828048..829781 | + | 1734 | WP_126317443.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15882.76 Da Isoelectric Point: 11.3523
>T287060 WP_003825515.1 NZ_LR134214:825265-825672 [Citrobacter portucalensis]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|