Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 201203..201942 | Replicon | chromosome |
Accession | NZ_LR134213 | ||
Organism | Klebsiella pneumoniae strain NCTC418 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4U9WP91 |
Locus tag | EL132_RS02590 | Protein ID | WP_004901283.1 |
Coordinates | 201457..201942 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | EL132_RS02585 | Protein ID | WP_003026799.1 |
Coordinates | 201203..201469 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL132_RS02570 | 196707..198776 | + | 2070 | WP_004901297.1 | glycine--tRNA ligase subunit beta | - |
EL132_RS02575 | 199072..200441 | + | 1370 | WP_087661561.1 | IS3 family transposase | - |
EL132_RS02580 | 200642..201070 | + | 429 | WP_004901287.1 | GFA family protein | - |
EL132_RS02585 | 201203..201469 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
EL132_RS02590 | 201457..201942 | + | 486 | WP_004901283.1 | GNAT family N-acetyltransferase | Toxin |
EL132_RS02595 | 202267..203313 | - | 1047 | WP_004173931.1 | IS481-like element ISKpn28 family transposase | - |
EL132_RS02600 | 203387..203539 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
EL132_RS02605 | 203841..205460 | + | 1620 | WP_004901278.1 | ATP-binding cassette domain-containing protein | - |
EL132_RS02610 | 205559..205771 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
EL132_RS02615 | 206023..206313 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 199716..203313 | 3597 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17594.32 Da Isoelectric Point: 10.1788
>T287049 WP_004901283.1 NZ_LR134213:201457-201942 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLNQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLNQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U9WP91 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |