Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 141788..142698 Replicon plasmid 2
Accession NZ_LR134211
Organism Klebsiella pneumoniae strain NCTC418

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag EL132_RS01005 Protein ID WP_004026354.1
Coordinates 141788..142258 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag EL132_RS01010 Protein ID WP_004026357.1
Coordinates 142255..142698 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL132_RS00980 137102..138070 + 969 WP_004225014.1 IS5 family transposase -
EL132_RS00985 138289..138447 - 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
EL132_RS00990 138519..139700 + 1182 WP_004883380.1 IS481 family transposase -
EL132_RS00995 140271..140531 + 261 WP_004026352.1 hypothetical protein -
EL132_RS01000 141127..141333 + 207 WP_004902422.1 hypothetical protein -
EL132_RS01005 141788..142258 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
EL132_RS01010 142255..142698 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
EL132_RS01015 142799..143302 - 504 Protein_151 DUF4113 domain-containing protein -
EL132_RS01020 143400..143621 - 222 WP_004213643.1 DUF2188 domain-containing protein -
EL132_RS01025 143766..143921 - 156 WP_004213642.1 hypothetical protein -
EL132_RS01030 143996..146122 - 2127 WP_004213640.1 TonB-dependent receptor family protein -
EL132_RS01035 146209..147162 - 954 Protein_155 fec operon regulator FecR -
EL132_RS01040 147159..147680 - 522 WP_004213635.1 sigma-70 family RNA polymerase sigma factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC / iroD / iroN / rmpA 1..205331 205331


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T287048 WP_004026354.1 NZ_LR134211:c142258-141788 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT287048 WP_004026357.1 NZ_LR134211:c142698-142255 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References