Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 122215..122885 Replicon plasmid 2
Accession NZ_LR134211
Organism Klebsiella pneumoniae strain NCTC418

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag EL132_RS00900 Protein ID WP_004213072.1
Coordinates 122215..122658 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag EL132_RS00905 Protein ID WP_004213073.1
Coordinates 122655..122885 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL132_RS00850 117625..117900 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
EL132_RS00855 117963..118454 + 492 WP_011251327.1 DM13 domain-containing protein -
EL132_RS00860 118503..119423 + 921 WP_004213934.1 DUF1471 domain-containing protein -
EL132_RS00870 119514..119920 + 407 Protein_124 GAF domain-containing protein -
EL132_RS28125 120435..121071 - 637 Protein_125 mucoid phenotype A regulator RmpA -
EL132_RS00890 121488..121781 + 294 Protein_126 transposase -
EL132_RS00895 121785..122201 + 417 Protein_127 restriction endonuclease -
EL132_RS00900 122215..122658 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
EL132_RS00905 122655..122885 - 231 WP_004213073.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EL132_RS00910 123493..124626 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
EL132_RS00915 124642..124935 + 294 WP_004213076.1 hypothetical protein -
EL132_RS00920 124925..125131 - 207 WP_004213077.1 hypothetical protein -
EL132_RS00925 125483..125773 + 291 WP_004213078.1 hypothetical protein -
EL132_RS00930 125763..126662 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC / iroD / iroN / rmpA 1..205331 205331


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T287047 WP_004213072.1 NZ_LR134211:c122658-122215 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT287047 WP_004213073.1 NZ_LR134211:c122885-122655 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References