Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 122215..122885 | Replicon | plasmid 2 |
| Accession | NZ_LR134211 | ||
| Organism | Klebsiella pneumoniae strain NCTC418 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | EL132_RS00900 | Protein ID | WP_004213072.1 |
| Coordinates | 122215..122658 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | EL132_RS00905 | Protein ID | WP_004213073.1 |
| Coordinates | 122655..122885 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL132_RS00850 | 117625..117900 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| EL132_RS00855 | 117963..118454 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| EL132_RS00860 | 118503..119423 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| EL132_RS00870 | 119514..119920 | + | 407 | Protein_124 | GAF domain-containing protein | - |
| EL132_RS28125 | 120435..121071 | - | 637 | Protein_125 | mucoid phenotype A regulator RmpA | - |
| EL132_RS00890 | 121488..121781 | + | 294 | Protein_126 | transposase | - |
| EL132_RS00895 | 121785..122201 | + | 417 | Protein_127 | restriction endonuclease | - |
| EL132_RS00900 | 122215..122658 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL132_RS00905 | 122655..122885 | - | 231 | WP_004213073.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL132_RS00910 | 123493..124626 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| EL132_RS00915 | 124642..124935 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| EL132_RS00920 | 124925..125131 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| EL132_RS00925 | 125483..125773 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| EL132_RS00930 | 125763..126662 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC / iroD / iroN / rmpA | 1..205331 | 205331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T287047 WP_004213072.1 NZ_LR134211:c122658-122215 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|