Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 57664..58400 | Replicon | plasmid 2 |
Accession | NZ_LR134211 | ||
Organism | Klebsiella pneumoniae strain NCTC418 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | EL132_RS00545 | Protein ID | WP_004098919.1 |
Coordinates | 57664..58146 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
Locus tag | EL132_RS00550 | Protein ID | WP_004213599.1 |
Coordinates | 58134..58400 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL132_RS00525 | 53018..54364 | + | 1347 | WP_011154555.1 | dihydroorotase | - |
EL132_RS00530 | 54428..55450 | + | 1023 | WP_004214536.1 | porphobilinogen synthase | - |
EL132_RS00535 | 55625..56020 | + | 396 | Protein_61 | DDE-type integrase/transposase/recombinase | - |
EL132_RS00540 | 56016..57243 | - | 1228 | Protein_62 | IS3 family transposase | - |
EL132_RS00545 | 57664..58146 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
EL132_RS00550 | 58134..58400 | - | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
EL132_RS00555 | 58574..58888 | - | 315 | Protein_65 | DNA-binding protein | - |
EL132_RS00560 | 58930..61899 | - | 2970 | WP_004213592.1 | Tn3 family transposase | - |
EL132_RS00565 | 61902..62459 | - | 558 | WP_004213590.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC / iroD / iroN / rmpA | 1..205331 | 205331 | |
- | inside | IScluster/Tn | - | - | 56016..62459 | 6443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T287046 WP_004098919.1 NZ_LR134211:c58146-57664 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J5Q928 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D3T1D0 |