Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 12498..13249 | Replicon | plasmid 2 |
Accession | NZ_LR134211 | ||
Organism | Klebsiella pneumoniae strain NCTC418 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | EL132_RS00290 | Protein ID | WP_004902249.1 |
Coordinates | 12767..13249 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | EL132_RS00285 | Protein ID | WP_004902250.1 |
Coordinates | 12498..12776 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL132_RS00250 | 7526..7816 | + | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
EL132_RS00255 | 7834..9099 | + | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
EL132_RS00260 | 9080..10750 | + | 1671 | WP_004902261.1 | AMP-binding protein | - |
EL132_RS28115 | 10988..11257 | + | 270 | WP_071591895.1 | hypothetical protein | - |
EL132_RS00275 | 11718..12059 | + | 342 | WP_004902257.1 | hypothetical protein | - |
EL132_RS00280 | 12167..12379 | + | 213 | WP_004902255.1 | hypothetical protein | - |
EL132_RS00285 | 12498..12776 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
EL132_RS00290 | 12767..13249 | + | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
EL132_RS00305 | 14284..14823 | + | 540 | WP_004902239.1 | hypothetical protein | - |
EL132_RS00310 | 14928..15320 | + | 393 | WP_045145491.1 | hypothetical protein | - |
EL132_RS00315 | 15421..16176 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
EL132_RS00320 | 16203..16850 | + | 648 | WP_014386537.1 | EcsC family protein | - |
EL132_RS00325 | 16982..17218 | - | 237 | Protein_20 | kinase | - |
EL132_RS00330 | 17275..18243 | - | 969 | WP_004225014.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC / iroD / iroN / rmpA | 1..205331 | 205331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T287045 WP_004902249.1 NZ_LR134211:12767-13249 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|