Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2520369..2521007 | Replicon | chromosome |
| Accession | NZ_LR134209 | ||
| Organism | Escherichia coli strain NCTC11476 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | EL080_RS12375 | Protein ID | WP_000813794.1 |
| Coordinates | 2520831..2521007 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL080_RS12370 | Protein ID | WP_001270286.1 |
| Coordinates | 2520369..2520785 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL080_RS12350 | 2515521..2516462 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| EL080_RS12355 | 2516463..2517476 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| EL080_RS12360 | 2517494..2518639 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| EL080_RS12365 | 2518884..2520290 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| EL080_RS12370 | 2520369..2520785 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EL080_RS12375 | 2520831..2521007 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EL080_RS12380 | 2521229..2521459 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| EL080_RS12385 | 2521550..2523511 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EL080_RS12390 | 2523584..2524120 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| EL080_RS12395 | 2524173..2525387 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2525427..2526575 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287040 WP_000813794.1 NZ_LR134209:c2521007-2520831 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287040 WP_001270286.1 NZ_LR134209:c2520785-2520369 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|