Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1012457..1013040 | Replicon | chromosome |
Accession | NZ_LR134209 | ||
Organism | Escherichia coli strain NCTC11476 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | EL080_RS04980 | Protein ID | WP_000254738.1 |
Coordinates | 1012705..1013040 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | EL080_RS04975 | Protein ID | WP_000581937.1 |
Coordinates | 1012457..1012705 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL080_RS04965 | 1008796..1010097 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
EL080_RS04970 | 1010145..1012379 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
EL080_RS04975 | 1012457..1012705 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EL080_RS04980 | 1012705..1013040 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
EL080_RS04985 | 1013111..1013902 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
EL080_RS04990 | 1014130..1015767 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
EL080_RS04995 | 1015855..1017153 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
EL080_RS05000 | 1017209..1017571 | - | 363 | WP_000034929.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T287033 WP_000254738.1 NZ_LR134209:1012705-1013040 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|