Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3603322..3603971 | Replicon | chromosome |
Accession | NZ_LR134205 | ||
Organism | Proteus mirabilis strain NCTC4199 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B4EZB9 |
Locus tag | EL062_RS16550 | Protein ID | WP_012368534.1 |
Coordinates | 3603322..3603741 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B4EZC0 |
Locus tag | EL062_RS16555 | Protein ID | WP_012368535.1 |
Coordinates | 3603738..3603971 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL062_RS16510 | 3598599..3599477 | - | 879 | WP_049203255.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
EL062_RS16515 | 3599653..3600567 | - | 915 | WP_004249085.1 | fatty acid biosynthesis protein FabY | - |
EL062_RS16520 | 3600591..3601028 | - | 438 | WP_004246810.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EL062_RS16525 | 3601109..3601726 | - | 618 | WP_004246809.1 | glucose-1-phosphatase | - |
EL062_RS16540 | 3602380..3602796 | - | 417 | WP_049208252.1 | hypothetical protein | - |
EL062_RS16545 | 3602774..3603097 | - | 324 | WP_049208253.1 | hypothetical protein | - |
EL062_RS16550 | 3603322..3603741 | - | 420 | WP_012368534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL062_RS16555 | 3603738..3603971 | - | 234 | WP_012368535.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL062_RS16560 | 3604722..3606557 | - | 1836 | WP_004246802.1 | ribosome-dependent GTPase TypA | - |
EL062_RS16565 | 3606917..3608326 | + | 1410 | WP_126402937.1 | glutamate--ammonia ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15371.88 Da Isoelectric Point: 7.7288
>T287028 WP_012368534.1 NZ_LR134205:c3603741-3603322 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|