Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3582750..3583449 | Replicon | chromosome |
Accession | NZ_LR134205 | ||
Organism | Proteus mirabilis strain NCTC4199 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B4EZ96 |
Locus tag | EL062_RS16435 | Protein ID | WP_004249093.1 |
Coordinates | 3582750..3583136 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | EL062_RS16440 | Protein ID | WP_004246828.1 |
Coordinates | 3583129..3583449 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL062_RS16420 | 3578769..3579350 | - | 582 | WP_004246833.1 | DNA-3-methyladenine glycosylase I | - |
EL062_RS16425 | 3579601..3580506 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
EL062_RS16430 | 3580516..3582588 | + | 2073 | WP_004246830.1 | glycine--tRNA ligase subunit beta | - |
EL062_RS16435 | 3582750..3583136 | + | 387 | WP_004249093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL062_RS16440 | 3583129..3583449 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL062_RS16445 | 3583498..3583932 | - | 435 | WP_004246827.1 | hypothetical protein | - |
EL062_RS16450 | 3583925..3584809 | - | 885 | WP_012368526.1 | endonuclease/exonuclease/phosphatase family protein | - |
EL062_RS16455 | 3585026..3586312 | - | 1287 | WP_049196833.1 | DUF3748 domain-containing protein | - |
EL062_RS16460 | 3586449..3587066 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
EL062_RS16465 | 3587368..3587991 | + | 624 | WP_004246821.1 | guanylate kinase | - |
EL062_RS16470 | 3588046..3588321 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14294.64 Da Isoelectric Point: 10.0642
>T287027 WP_004249093.1 NZ_LR134205:3582750-3583136 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|