Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1425415..1426060 Replicon chromosome
Accession NZ_LR134205
Organism Proteus mirabilis strain NCTC4199

Toxin (Protein)


Gene name hicA Uniprot ID B4ET86
Locus tag EL062_RS06545 Protein ID WP_004247035.1
Coordinates 1425875..1426060 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B4ET85
Locus tag EL062_RS06540 Protein ID WP_004247034.1
Coordinates 1425415..1425828 (-) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL062_RS17790 1420969..1421127 - 159 WP_004247025.1 hypothetical protein -
EL062_RS17795 1421579..1421755 + 177 WP_004247793.1 hypothetical protein -
EL062_RS06510 1421924..1422670 - 747 WP_012367749.1 class I SAM-dependent methyltransferase -
EL062_RS06520 1423520..1424098 + 579 WP_004247796.1 alpha/beta hydrolase -
EL062_RS06525 1424211..1424504 - 294 Protein_1245 LysE family transporter -
EL062_RS06535 1424678..1425319 - 642 WP_065424673.1 response regulator -
EL062_RS06540 1425415..1425828 - 414 WP_004247034.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
EL062_RS06545 1425875..1426060 - 186 WP_004247035.1 type II toxin-antitoxin system HicA family toxin Toxin
EL062_RS06550 1426171..1426941 + 771 Protein_1249 DUF1073 domain-containing protein -
EL062_RS06560 1427500..1428050 - 551 Protein_1250 PH domain-containing protein -
EL062_RS06565 1428114..1428428 - 315 WP_012367751.1 hypothetical protein -
EL062_RS06575 1428845..1430578 - 1734 WP_017628394.1 LPS biosynthesis-modulating metalloenzyme YejM -
EL062_RS06580 1430602..1430829 - 228 WP_004247042.1 YejL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1419284..1438051 18767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7049.30 Da        Isoelectric Point: 10.9659

>T287025 WP_004247035.1 NZ_LR134205:c1426060-1425875 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN

Download         Length: 186 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 15251.98 Da        Isoelectric Point: 4.3830

>AT287025 WP_004247034.1 NZ_LR134205:c1425828-1425415 [Proteus mirabilis]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB B4ET86

Antitoxin

Source ID Structure
AlphaFold DB B4ET85

References