Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1425415..1426060 | Replicon | chromosome |
| Accession | NZ_LR134205 | ||
| Organism | Proteus mirabilis strain NCTC4199 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B4ET86 |
| Locus tag | EL062_RS06545 | Protein ID | WP_004247035.1 |
| Coordinates | 1425875..1426060 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | B4ET85 |
| Locus tag | EL062_RS06540 | Protein ID | WP_004247034.1 |
| Coordinates | 1425415..1425828 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL062_RS17790 | 1420969..1421127 | - | 159 | WP_004247025.1 | hypothetical protein | - |
| EL062_RS17795 | 1421579..1421755 | + | 177 | WP_004247793.1 | hypothetical protein | - |
| EL062_RS06510 | 1421924..1422670 | - | 747 | WP_012367749.1 | class I SAM-dependent methyltransferase | - |
| EL062_RS06520 | 1423520..1424098 | + | 579 | WP_004247796.1 | alpha/beta hydrolase | - |
| EL062_RS06525 | 1424211..1424504 | - | 294 | Protein_1245 | LysE family transporter | - |
| EL062_RS06535 | 1424678..1425319 | - | 642 | WP_065424673.1 | response regulator | - |
| EL062_RS06540 | 1425415..1425828 | - | 414 | WP_004247034.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL062_RS06545 | 1425875..1426060 | - | 186 | WP_004247035.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL062_RS06550 | 1426171..1426941 | + | 771 | Protein_1249 | DUF1073 domain-containing protein | - |
| EL062_RS06560 | 1427500..1428050 | - | 551 | Protein_1250 | PH domain-containing protein | - |
| EL062_RS06565 | 1428114..1428428 | - | 315 | WP_012367751.1 | hypothetical protein | - |
| EL062_RS06575 | 1428845..1430578 | - | 1734 | WP_017628394.1 | LPS biosynthesis-modulating metalloenzyme YejM | - |
| EL062_RS06580 | 1430602..1430829 | - | 228 | WP_004247042.1 | YejL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1419284..1438051 | 18767 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7049.30 Da Isoelectric Point: 10.9659
>T287025 WP_004247035.1 NZ_LR134205:c1426060-1425875 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15251.98 Da Isoelectric Point: 4.3830
>AT287025 WP_004247034.1 NZ_LR134205:c1425828-1425415 [Proteus mirabilis]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|