Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 11795..12396 | Replicon | chromosome |
Accession | NZ_LR134205 | ||
Organism | Proteus mirabilis strain NCTC4199 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A2X2BIG8 |
Locus tag | EL062_RS00050 | Protein ID | WP_004246497.1 |
Coordinates | 11795..12178 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A1Z1SPN9 |
Locus tag | EL062_RS00055 | Protein ID | WP_004246496.1 |
Coordinates | 12175..12396 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL062_RS00030 | 7728..8291 | + | 564 | WP_012368640.1 | methyltransferase | - |
EL062_RS00035 | 8567..9466 | + | 900 | WP_124725698.1 | N-acetylmuramic acid 6-phosphate etherase | - |
EL062_RS00040 | 9823..11061 | - | 1239 | WP_126402683.1 | HipA domain-containing protein | - |
EL062_RS00045 | 11074..11388 | - | 315 | WP_004246498.1 | helix-turn-helix domain-containing protein | - |
EL062_RS00050 | 11795..12178 | - | 384 | WP_004246497.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
EL062_RS00055 | 12175..12396 | - | 222 | WP_004246496.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL062_RS00060 | 12677..13540 | - | 864 | WP_004249947.1 | YicC family protein | - |
EL062_RS00065 | 13667..14383 | + | 717 | WP_004249760.1 | ribonuclease PH | - |
EL062_RS00070 | 14465..15109 | + | 645 | WP_126402684.1 | orotate phosphoribosyltransferase | - |
EL062_RS00075 | 15428..16033 | - | 606 | WP_004246491.1 | nucleoid occlusion factor SlmA | - |
EL062_RS00080 | 16153..16611 | - | 459 | WP_004246490.1 | dUTP diphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14471.53 Da Isoelectric Point: 8.5125
>T287024 WP_004246497.1 NZ_LR134205:c12178-11795 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X2BIG8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Z1SPN9 |