Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1641675..1642265 | Replicon | chromosome |
| Accession | NZ_LR134201 | ||
| Organism | Cedecea lapagei strain NCTC11466 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | EL098_RS07975 | Protein ID | WP_126355744.1 |
| Coordinates | 1641933..1642265 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | EL098_RS07970 | Protein ID | WP_126355743.1 |
| Coordinates | 1641675..1641932 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL098_RS07940 | 1637104..1637214 | + | 111 | Protein_1529 | PbsX family transcriptional regulator | - |
| EL098_RS07945 | 1637270..1638064 | + | 795 | WP_164716797.1 | hypothetical protein | - |
| EL098_RS07950 | 1638482..1639375 | + | 894 | WP_126355741.1 | hypothetical protein | - |
| EL098_RS07955 | 1639426..1640544 | + | 1119 | WP_126355742.1 | threonine/serine transporter | - |
| EL098_RS07960 | 1640548..1641348 | - | 801 | WP_126358383.1 | MBL fold metallo-hydrolase | - |
| EL098_RS07965 | 1641433..1641625 | + | 193 | Protein_1534 | hypothetical protein | - |
| EL098_RS07970 | 1641675..1641932 | + | 258 | WP_126355743.1 | antitoxin | Antitoxin |
| EL098_RS07975 | 1641933..1642265 | + | 333 | WP_126355744.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL098_RS07985 | 1642582..1643379 | - | 798 | WP_126355745.1 | DgsA anti-repressor MtfA | - |
| EL098_RS07995 | 1643801..1644136 | + | 336 | WP_126355746.1 | multidrug DMT transporter | - |
| EL098_RS08000 | 1644152..1645477 | - | 1326 | WP_126355747.1 | MFS transporter | - |
| EL098_RS08005 | 1645515..1646784 | - | 1270 | Protein_1540 | MASE1 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11745.59 Da Isoelectric Point: 10.1863
>T287019 WP_126355744.1 NZ_LR134201:1641933-1642265 [Cedecea lapagei]
MDRGEIWLVSLDPIAGHEQSGKFPVLIVSKASFNKLARLPVVVPVTSGGNFTRTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARSGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKFPVLIVSKASFNKLARLPVVVPVTSGGNFTRTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARSGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|