Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1063102..1063719 | Replicon | chromosome |
Accession | NZ_LR134201 | ||
Organism | Cedecea lapagei strain NCTC11466 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | S3J5Z6 |
Locus tag | EL098_RS05240 | Protein ID | WP_008460299.1 |
Coordinates | 1063102..1063317 (-) | Length | 72 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A1X7LVC3 |
Locus tag | EL098_RS05245 | Protein ID | WP_008460297.1 |
Coordinates | 1063345..1063719 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL098_RS05215 | 1059274..1061178 | + | 1905 | WP_126355298.1 | methyl-accepting chemotaxis protein | - |
EL098_RS05220 | 1061303..1061563 | + | 261 | WP_008460319.1 | type B 50S ribosomal protein L31 | - |
EL098_RS05225 | 1061567..1061707 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
EL098_RS05230 | 1061711..1062187 | - | 477 | WP_126355299.1 | YlaC family protein | - |
EL098_RS05235 | 1062308..1062859 | - | 552 | WP_126355300.1 | maltose O-acetyltransferase | - |
EL098_RS05240 | 1063102..1063317 | - | 216 | WP_008460299.1 | hemolysin expression modulator Hha | Toxin |
EL098_RS05245 | 1063345..1063719 | - | 375 | WP_008460297.1 | Hha toxicity modulator TomB | Antitoxin |
EL098_RS05250 | 1064283..1067432 | - | 3150 | WP_126355301.1 | multidrug efflux RND transporter permease subunit AcrB | - |
EL098_RS05255 | 1067455..1068654 | - | 1200 | WP_126355302.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8526.94 Da Isoelectric Point: 9.4828
>T287015 WP_008460299.1 NZ_LR134201:c1063317-1063102 [Cedecea lapagei]
MTTKLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MTTKLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 216 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14459.17 Da Isoelectric Point: 5.1574
>AT287015 WP_008460297.1 NZ_LR134201:c1063719-1063345 [Cedecea lapagei]
MDEYSPKRHDIAQLKFLCESLYHDCLTNLGESNHGWVNDPTSAINLQLNELIEHIAASALNYKIKYPDESKLIEQIDEYL
DDTFMLFSNYGINAQDLQRWRKSGNRLFRCFISESRANPVSHSF
MDEYSPKRHDIAQLKFLCESLYHDCLTNLGESNHGWVNDPTSAINLQLNELIEHIAASALNYKIKYPDESKLIEQIDEYL
DDTFMLFSNYGINAQDLQRWRKSGNRLFRCFISESRANPVSHSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X7LUT2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X7LVC3 |