Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1007394..1007950 | Replicon | chromosome |
Accession | NZ_LR134201 | ||
Organism | Cedecea lapagei strain NCTC11466 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | EL098_RS04980 | Protein ID | WP_126355253.1 |
Coordinates | 1007394..1007705 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | EL098_RS04985 | Protein ID | WP_126355254.1 |
Coordinates | 1007708..1007950 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL098_RS04960 | 1003174..1004640 | + | 1467 | WP_126355250.1 | IMP dehydrogenase | - |
EL098_RS04965 | 1004708..1006285 | + | 1578 | WP_045783526.1 | glutamine-hydrolyzing GMP synthase | - |
EL098_RS04970 | 1006548..1006781 | + | 234 | WP_126355251.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EL098_RS04975 | 1006812..1007144 | + | 333 | WP_126355252.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL098_RS04980 | 1007394..1007705 | - | 312 | WP_126355253.1 | CcdB family protein | Toxin |
EL098_RS04985 | 1007708..1007950 | - | 243 | WP_126355254.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
EL098_RS04990 | 1008164..1009369 | + | 1206 | WP_126355255.1 | M24 family metallopeptidase | - |
EL098_RS04995 | 1009411..1010028 | - | 618 | WP_126355256.1 | LysE family transporter | - |
EL098_RS05000 | 1010213..1011133 | + | 921 | WP_126355257.1 | LysR family transcriptional regulator | - |
EL098_RS05005 | 1011127..1012143 | - | 1017 | WP_126355258.1 | LD-carboxypeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11564.26 Da Isoelectric Point: 7.1614
>T287014 WP_126355253.1 NZ_LR134201:c1007705-1007394 [Cedecea lapagei]
MQFTVYKNTGKPTAYPYLLNVQSNIIGRRNTRVVIPLFPAENYKGPRTDKLTPSINLAGEDFIVMTHELASIPERVLGAE
HCSAAEYENTIKAALNFLFYGIE
MQFTVYKNTGKPTAYPYLLNVQSNIIGRRNTRVVIPLFPAENYKGPRTDKLTPSINLAGEDFIVMTHELASIPERVLGAE
HCSAAEYENTIKAALNFLFYGIE
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|