Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
Location | 831603..832400 | Replicon | chromosome |
Accession | NZ_LR134201 | ||
Organism | Cedecea lapagei strain NCTC11466 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | EL098_RS04195 | Protein ID | WP_126355027.1 |
Coordinates | 831876..832400 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | EL098_RS04190 | Protein ID | WP_126355025.1 |
Coordinates | 831603..831872 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL098_RS04160 | 827108..827788 | + | 681 | WP_126355014.1 | nitroreductase | - |
EL098_RS04165 | 827785..828651 | - | 867 | WP_126355016.1 | EamA family transporter | - |
EL098_RS04170 | 828744..829529 | + | 786 | WP_126355018.1 | helix-turn-helix transcriptional regulator | - |
EL098_RS04175 | 829601..829936 | - | 336 | WP_126355020.1 | hypothetical protein | - |
EL098_RS04180 | 830086..830391 | - | 306 | WP_126355022.1 | chaperone modulator CbpM | - |
EL098_RS04185 | 830391..831311 | - | 921 | WP_126355023.1 | curved DNA-binding protein | - |
EL098_RS04190 | 831603..831872 | + | 270 | WP_126355025.1 | DUF1778 domain-containing protein | Antitoxin |
EL098_RS04195 | 831876..832400 | + | 525 | WP_126355027.1 | GNAT family N-acetyltransferase | Toxin |
EL098_RS04200 | 832574..833158 | + | 585 | WP_126355029.1 | hypothetical protein | - |
EL098_RS04205 | 833451..833930 | + | 480 | WP_126355031.1 | Rrf2 family transcriptional regulator | - |
EL098_RS04210 | 834033..837185 | - | 3153 | WP_126355033.1 | multidrug efflux RND transporter permease subunit OqxB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19402.13 Da Isoelectric Point: 7.7633
>T287013 WP_126355027.1 NZ_LR134201:831876-832400 [Cedecea lapagei]
VADLTIELFSADTAYDFCGFDCGDTCLNAFLAEHFIRQHNGRFLRGYLLVTKDANPKVLGYYTLSGSCFEKETLPSNSQK
RKIPYANVPSVTLGRLAIHKDLQGQEWGSTLVAHAMKVVYLASQAVGVHGIFVDAINDNAKRFYQKLGFITLVGKNANSL
FYPTRSIETLFEHQ
VADLTIELFSADTAYDFCGFDCGDTCLNAFLAEHFIRQHNGRFLRGYLLVTKDANPKVLGYYTLSGSCFEKETLPSNSQK
RKIPYANVPSVTLGRLAIHKDLQGQEWGSTLVAHAMKVVYLASQAVGVHGIFVDAINDNAKRFYQKLGFITLVGKNANSL
FYPTRSIETLFEHQ
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|