Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 615983..616652 | Replicon | chromosome |
| Accession | NZ_LR134201 | ||
| Organism | Cedecea lapagei strain NCTC11466 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | EL098_RS03155 | Protein ID | WP_126354697.1 |
| Coordinates | 616230..616652 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | EL098_RS03150 | Protein ID | WP_126354695.1 |
| Coordinates | 615983..616249 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL098_RS03130 | 612501..613229 | - | 729 | WP_126354687.1 | MurR/RpiR family transcriptional regulator | - |
| EL098_RS03135 | 613272..613865 | - | 594 | WP_126354689.1 | HD domain-containing protein | - |
| EL098_RS03140 | 614045..614698 | + | 654 | WP_126354691.1 | hemolysin III family protein | - |
| EL098_RS03145 | 614750..615736 | - | 987 | WP_126354693.1 | tRNA-modifying protein YgfZ | - |
| EL098_RS03150 | 615983..616249 | + | 267 | WP_126354695.1 | FAD assembly factor SdhE | Antitoxin |
| EL098_RS03155 | 616230..616652 | + | 423 | WP_126354697.1 | protein YgfX | Toxin |
| EL098_RS03160 | 616649..617170 | - | 522 | WP_126354699.1 | flavodoxin FldB | - |
| EL098_RS03165 | 617273..618169 | + | 897 | WP_126354701.1 | site-specific tyrosine recombinase XerD | - |
| EL098_RS03170 | 618196..618912 | + | 717 | WP_126354703.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL098_RS03175 | 618919..620652 | + | 1734 | WP_126354705.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16491.50 Da Isoelectric Point: 11.4781
>T287012 WP_126354697.1 NZ_LR134201:616230-616652 [Cedecea lapagei]
VVLWQSDLRVSWRAQWMSLLLHGMVALLVLLMPWPMSYTLIWMLLLSLVVFDSVRSQRRIHARQGEIKLLTDCRLRWQGR
EWDIVGNPWLIDSGAMLRLRRAGKQRCQHLWLAADSMDIGEWRDLRRLLMQQQASGSGQI
VVLWQSDLRVSWRAQWMSLLLHGMVALLVLLMPWPMSYTLIWMLLLSLVVFDSVRSQRRIHARQGEIKLLTDCRLRWQGR
EWDIVGNPWLIDSGAMLRLRRAGKQRCQHLWLAADSMDIGEWRDLRRLLMQQQASGSGQI
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|