Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3880014..3880633 Replicon chromosome
Accession NZ_LR134196
Organism Klebsiella quasipneumoniae strain NCTC11357

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag EL110_RS19155 Protein ID WP_002892050.1
Coordinates 3880415..3880633 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag EL110_RS19150 Protein ID WP_002892066.1
Coordinates 3880014..3880388 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL110_RS19140 3875167..3876360 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
EL110_RS19145 3876383..3879529 + 3147 WP_004204748.1 multidrug efflux RND transporter permease subunit -
EL110_RS19150 3880014..3880388 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
EL110_RS19155 3880415..3880633 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
EL110_RS19160 3880792..3881358 + 567 WP_004204750.1 maltose O-acetyltransferase -
EL110_RS25600 3881330..3881452 - 123 WP_032426076.1 hypothetical protein -
EL110_RS19165 3881495..3881965 + 471 WP_004204751.1 YlaC family protein -
EL110_RS19170 3881934..3883391 - 1458 WP_004204752.1 PLP-dependent aminotransferase family protein -
EL110_RS19175 3883492..3884190 + 699 WP_004204753.1 GNAT family N-acetyltransferase -
EL110_RS19180 3884187..3884327 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
EL110_RS19185 3884327..3884590 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T287009 WP_002892050.1 NZ_LR134196:3880415-3880633 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT287009 WP_002892066.1 NZ_LR134196:3880014-3880388 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References