Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 315336..315922 Replicon chromosome
Accession NZ_LR134196
Organism Klebsiella quasipneumoniae strain NCTC11357

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag EL110_RS01485 Protein ID WP_126494053.1
Coordinates 315554..315922 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag EL110_RS01480 Protein ID WP_048295677.1
Coordinates 315336..315557 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL110_RS01460 311493..312419 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EL110_RS01465 312416..313693 + 1278 WP_004202111.1 branched chain amino acid ABC transporter permease LivM -
EL110_RS01470 313690..314457 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EL110_RS01475 314459..315172 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EL110_RS01480 315336..315557 + 222 WP_048295677.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL110_RS01485 315554..315922 + 369 WP_126494053.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL110_RS01490 316214..317530 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EL110_RS01495 317637..318524 + 888 WP_004202113.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EL110_RS01500 318521..319366 + 846 WP_023319266.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EL110_RS01505 319368..320438 + 1071 WP_017899977.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 305171..321175 16004


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T287002 WP_126494053.1 NZ_LR134196:315554-315922 [Klebsiella quasipneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLIKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8135.20 Da        Isoelectric Point: 5.0637

>AT287002 WP_048295677.1 NZ_LR134196:315336-315557 [Klebsiella quasipneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGVEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References