Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4724418..4724985 | Replicon | chromosome |
| Accession | NZ_LR134195 | ||
| Organism | Raoultella ornithinolytica strain NCTC13096 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | EL106_RS22400 | Protein ID | WP_126509934.1 |
| Coordinates | 4724710..4724985 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | EL106_RS22395 | Protein ID | WP_075808907.1 |
| Coordinates | 4724418..4724723 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL106_RS22370 | 4719625..4720689 | - | 1065 | WP_004857527.1 | DUF2955 domain-containing protein | - |
| EL106_RS22375 | 4720679..4721746 | - | 1068 | WP_004857525.1 | HlyD family secretion protein | - |
| EL106_RS22380 | 4721753..4722217 | - | 465 | WP_004857523.1 | MarR family transcriptional regulator | - |
| EL106_RS22385 | 4722508..4722672 | - | 165 | WP_004857521.1 | DUF1127 domain-containing protein | - |
| EL106_RS22390 | 4722850..4724262 | + | 1413 | WP_015585221.1 | PLP-dependent aminotransferase family protein | - |
| EL106_RS22395 | 4724418..4724723 | - | 306 | WP_075808907.1 | BrnA antitoxin family protein | Antitoxin |
| EL106_RS22400 | 4724710..4724985 | - | 276 | WP_126509934.1 | BrnT family toxin | Toxin |
| EL106_RS22405 | 4725102..4725521 | - | 420 | WP_099842693.1 | FosA family fosfomycin resistance glutathione transferase | - |
| EL106_RS22410 | 4725515..4726423 | - | 909 | WP_126509935.1 | LysR family transcriptional regulator | - |
| EL106_RS22415 | 4726511..4727293 | + | 783 | WP_126509936.1 | NAD(P)H-dependent oxidoreductase | - |
| EL106_RS22420 | 4727441..4728019 | + | 579 | WP_004857495.1 | TetR/AcrR family transcriptional regulator | - |
| EL106_RS22425 | 4728163..4728975 | + | 813 | WP_004857492.1 | winged helix-turn-helix domain-containing protein | - |
| EL106_RS22430 | 4728972..4729490 | + | 519 | WP_015585229.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10602.96 Da Isoelectric Point: 6.7600
>T287001 WP_126509934.1 NZ_LR134195:c4724985-4724710 [Raoultella ornithinolytica]
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRHERYENGEYRWQTIGLVHGVIVVLVAHSIRFESGTEVIRIIS
ARKADKNYEHG
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRHERYENGEYRWQTIGLVHGVIVVLVAHSIRFESGTEVIRIIS
ARKADKNYEHG
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|