Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4158378..4158997 | Replicon | chromosome |
Accession | NZ_LR134195 | ||
Organism | Raoultella ornithinolytica strain NCTC13096 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A514EV16 |
Locus tag | EL106_RS19680 | Protein ID | WP_004858783.1 |
Coordinates | 4158779..4158997 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A514EV88 |
Locus tag | EL106_RS19675 | Protein ID | WP_004858785.1 |
Coordinates | 4158378..4158752 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL106_RS19665 | 4153488..4154681 | + | 1194 | WP_004858789.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
EL106_RS19670 | 4154704..4157850 | + | 3147 | WP_004858787.1 | multidrug efflux RND transporter permease subunit | - |
EL106_RS19675 | 4158378..4158752 | + | 375 | WP_004858785.1 | Hha toxicity modulator TomB | Antitoxin |
EL106_RS19680 | 4158779..4158997 | + | 219 | WP_004858783.1 | hemolysin expression modulator Hha | Toxin |
EL106_RS19685 | 4159149..4159715 | + | 567 | WP_004858781.1 | maltose O-acetyltransferase | - |
EL106_RS19690 | 4159815..4160285 | + | 471 | WP_004858780.1 | YlaC family protein | - |
EL106_RS19695 | 4160260..4161711 | - | 1452 | WP_126509892.1 | PLP-dependent aminotransferase family protein | - |
EL106_RS19700 | 4161815..4162525 | + | 711 | WP_015585015.1 | GNAT family N-acetyltransferase | - |
EL106_RS19705 | 4162522..4162662 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
EL106_RS19710 | 4162665..4162925 | - | 261 | WP_004858777.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8570.90 Da Isoelectric Point: 7.9907
>T287000 WP_004858783.1 NZ_LR134195:4158779-4158997 [Raoultella ornithinolytica]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14411.19 Da Isoelectric Point: 4.8989
>AT287000 WP_004858785.1 NZ_LR134195:4158378-4158752 [Raoultella ornithinolytica]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EV16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EV88 |