Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2725078..2725829 | Replicon | chromosome |
Accession | NZ_LR134195 | ||
Organism | Raoultella ornithinolytica strain NCTC13096 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | EL106_RS12900 | Protein ID | WP_126509690.1 |
Coordinates | 2725347..2725829 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A808Y4Y8 |
Locus tag | EL106_RS12895 | Protein ID | WP_015584326.1 |
Coordinates | 2725078..2725356 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL106_RS12885 | 2721867..2722364 | + | 498 | WP_048023692.1 | hypothetical protein | - |
EL106_RS12890 | 2722522..2724447 | - | 1926 | WP_126509688.1 | C1 family peptidase | - |
EL106_RS12895 | 2725078..2725356 | + | 279 | WP_015584326.1 | DUF1778 domain-containing protein | Antitoxin |
EL106_RS12900 | 2725347..2725829 | + | 483 | WP_126509690.1 | GNAT family N-acetyltransferase | Toxin |
EL106_RS25855 | 2726014..2726364 | + | 351 | WP_044351090.1 | hypothetical protein | - |
EL106_RS12910 | 2726652..2727989 | - | 1338 | WP_126509692.1 | hypothetical protein | - |
EL106_RS12915 | 2728016..2728699 | - | 684 | WP_126509693.1 | hypothetical protein | - |
EL106_RS12920 | 2728869..2729006 | + | 138 | Protein_2493 | transposase | - |
EL106_RS12925 | 2729397..2729786 | + | 390 | WP_126509695.1 | hypothetical protein | - |
EL106_RS12930 | 2729752..2730099 | + | 348 | WP_126509697.1 | hypothetical protein | - |
EL106_RS25920 | 2730238..2730756 | + | 519 | WP_197719528.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2722522..2734930 | 12408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17616.47 Da Isoelectric Point: 9.7381
>T286998 WP_126509690.1 NZ_LR134195:2725347-2725829 [Raoultella ornithinolytica]
MGMRPPEPLSAGHNIAEFCCQDQVLNEWLKKKALKNHSTGISRVFVVCAENTKRVIAYYSLSSGSVHRNTVTGAYRRNAP
EAVPVIVLGRLAVDAAWAGKGLGAALLKDAIYRTEHIAVQVGVRALLVHALNDEVREFYTRFGFEPSIINTLTLLFPIKV
MGMRPPEPLSAGHNIAEFCCQDQVLNEWLKKKALKNHSTGISRVFVVCAENTKRVIAYYSLSSGSVHRNTVTGAYRRNAP
EAVPVIVLGRLAVDAAWAGKGLGAALLKDAIYRTEHIAVQVGVRALLVHALNDEVREFYTRFGFEPSIINTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|