Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 2395340..2396253 | Replicon | chromosome |
Accession | NZ_LR134195 | ||
Organism | Raoultella ornithinolytica strain NCTC13096 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | EL106_RS11235 | Protein ID | WP_069475889.1 |
Coordinates | 2395340..2395813 (-) | Length | 158 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A808Y7A4 |
Locus tag | EL106_RS11240 | Protein ID | WP_004862777.1 |
Coordinates | 2395810..2396253 (-) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL106_RS11210 | 2391379..2391987 | - | 609 | WP_044349854.1 | glutathione S-transferase family protein | - |
EL106_RS11215 | 2392229..2393134 | + | 906 | WP_032716408.1 | transcriptional regulator GcvA | - |
EL106_RS11220 | 2393162..2394067 | - | 906 | WP_126509578.1 | LysR family transcriptional regulator | - |
EL106_RS11225 | 2394170..2394487 | + | 318 | WP_126509579.1 | nuclear transport factor 2 family protein | - |
EL106_RS11230 | 2394480..2395259 | + | 780 | WP_118860327.1 | SDR family oxidoreductase | - |
EL106_RS11235 | 2395340..2395813 | - | 474 | WP_069475889.1 | RES domain-containing protein | Toxin |
EL106_RS11240 | 2395810..2396253 | - | 444 | WP_004862777.1 | DUF2384 domain-containing protein | Antitoxin |
EL106_RS11245 | 2398824..2399390 | - | 567 | WP_126509581.1 | DJ-1/PfpI family protein | - |
EL106_RS11250 | 2399985..2400968 | + | 984 | WP_126509583.1 | type I-F CRISPR-associated endonuclease Cas1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17540.86 Da Isoelectric Point: 4.8081
>T286997 WP_069475889.1 NZ_LR134195:c2395813-2395340 [Raoultella ornithinolytica]
MIFYRLVTGRYASEAWTGSGANQYGGRWNHQGHPAVYVSTSIALASLEILVHVKNEAILNQYQLYSIEIPDSEVESLDKQ
WLPDNWQENPMPVSTMDLGTGWLQSGSGLALMLPSCIIPYENNAILNPLHPAFSEALASVRQYPFTFDPRLARSTLL
MIFYRLVTGRYASEAWTGSGANQYGGRWNHQGHPAVYVSTSIALASLEILVHVKNEAILNQYQLYSIEIPDSEVESLDKQ
WLPDNWQENPMPVSTMDLGTGWLQSGSGLALMLPSCIIPYENNAILNPLHPAFSEALASVRQYPFTFDPRLARSTLL
Download Length: 474 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16190.45 Da Isoelectric Point: 4.9405
>AT286997 WP_004862777.1 NZ_LR134195:c2396253-2395810 [Raoultella ornithinolytica]
MKTWVPAEQPADNALWRYAGLPANRGMQLIELLSMGLPVSILDNIHEWTEMSKTDILRITGINERNVARRKSAGGTLTPG
ESERVARFVRVLDTAVDYFGSKQDAYDWLQSPVRGLGNVAPIDLIATESGALEVTDLIGRLEHGVFA
MKTWVPAEQPADNALWRYAGLPANRGMQLIELLSMGLPVSILDNIHEWTEMSKTDILRITGINERNVARRKSAGGTLTPG
ESERVARFVRVLDTAVDYFGSKQDAYDWLQSPVRGLGNVAPIDLIATESGALEVTDLIGRLEHGVFA
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|