Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 872220..872877 | Replicon | chromosome |
Accession | NZ_LR134195 | ||
Organism | Raoultella ornithinolytica strain NCTC13096 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A808XTM6 |
Locus tag | EL106_RS04225 | Protein ID | WP_004867355.1 |
Coordinates | 872467..872877 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A514ELX1 |
Locus tag | EL106_RS04220 | Protein ID | WP_004867358.1 |
Coordinates | 872220..872486 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL106_RS04195 | 867355..868788 | - | 1434 | WP_086815888.1 | 6-phospho-beta-glucosidase | - |
EL106_RS04200 | 868908..869636 | - | 729 | WP_004867368.1 | MurR/RpiR family transcriptional regulator | - |
EL106_RS04205 | 869686..869997 | + | 312 | WP_004867365.1 | N(4)-acetylcytidine aminohydrolase | - |
EL106_RS04210 | 870159..870818 | + | 660 | WP_004867362.1 | hemolysin III family protein | - |
EL106_RS04215 | 870940..871923 | - | 984 | WP_015585783.1 | tRNA-modifying protein YgfZ | - |
EL106_RS04220 | 872220..872486 | + | 267 | WP_004867358.1 | FAD assembly factor SdhE | Antitoxin |
EL106_RS04225 | 872467..872877 | + | 411 | WP_004867355.1 | protein YgfX | Toxin |
EL106_RS04230 | 872892..873407 | - | 516 | Protein_822 | flavodoxin FldB | - |
EL106_RS04235 | 873585..874481 | + | 897 | WP_015585784.1 | site-specific tyrosine recombinase XerD | - |
EL106_RS04240 | 874523..875218 | + | 696 | WP_126509392.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL106_RS04245 | 875224..876956 | + | 1733 | Protein_825 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16226.16 Da Isoelectric Point: 11.3349
>T286992 WP_004867355.1 NZ_LR134195:872467-872877 [Raoultella ornithinolytica]
VVLWQSDLRISWRSQWFSLLLHGIVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWIAADSMDAKEWRDLRRLVLQKPAQE
VVLWQSDLRISWRSQWFSLLLHGIVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWIAADSMDAKEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A808XTM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514ELX1 |