Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 67101..67648 | Replicon | chromosome |
Accession | NZ_LR134195 | ||
Organism | Raoultella ornithinolytica strain NCTC13096 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A808XUV0 |
Locus tag | EL106_RS00315 | Protein ID | WP_048025274.1 |
Coordinates | 67101..67409 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | EL106_RS00320 | Protein ID | WP_126509333.1 |
Coordinates | 67412..67648 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL106_RS00285 | 62280..62582 | - | 303 | WP_015585486.1 | PTS lactose/cellobiose transporter subunit IIA | - |
EL106_RS00290 | 62717..64042 | - | 1326 | WP_126509332.1 | PTS sugar transporter subunit IIC | - |
EL106_RS00295 | 64054..64368 | - | 315 | WP_004869063.1 | PTS sugar transporter subunit IIB | - |
EL106_RS00300 | 64663..65604 | + | 942 | WP_015585487.1 | LacI family transcriptional regulator | - |
EL106_RS00305 | 65699..65974 | - | 276 | WP_162769256.1 | hypothetical protein | - |
EL106_RS00310 | 66083..66985 | - | 903 | WP_015585496.1 | EamA family transporter | - |
EL106_RS00315 | 67101..67409 | - | 309 | WP_048025274.1 | CcdB family protein | Toxin |
EL106_RS00320 | 67412..67648 | - | 237 | WP_126509333.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
EL106_RS00325 | 67754..69187 | - | 1434 | WP_069476354.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
EL106_RS00330 | 69212..70114 | - | 903 | WP_088402359.1 | N-acetylmuramic acid 6-phosphate etherase | - |
EL106_RS00335 | 70279..71442 | - | 1164 | WP_004869055.1 | multidrug effflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11778.62 Da Isoelectric Point: 6.7156
>T286991 WP_048025274.1 NZ_LR134195:c67409-67101 [Raoultella ornithinolytica]
IQYYVYKNTGRITVYPYLLDVQSDIIGMRNTRVVIPLFPLRNYKGPRADRLTPVVTVEGEEYVVMTHELASIPQRVLGEE
VCHLNHQREVVKASIDFLFDGI
IQYYVYKNTGRITVYPYLLDVQSDIIGMRNTRVVIPLFPLRNYKGPRADRLTPVVTVEGEEYVVMTHELASIPQRVLGEE
VCHLNHQREVVKASIDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|