Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2150564..2151093 | Replicon | chromosome |
| Accession | NZ_LR134193 | ||
| Organism | Staphylococcus aureus strain NCTC13616 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | EL036_RS11040 | Protein ID | WP_000621175.1 |
| Coordinates | 2150564..2150926 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | EL036_RS11045 | Protein ID | WP_000948330.1 |
| Coordinates | 2150923..2151093 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL036_RS11015 | 2147542..2148312 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| EL036_RS11020 | 2148287..2148766 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| EL036_RS11025 | 2148768..2149094 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| EL036_RS11030 | 2149214..2150215 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| EL036_RS11040 | 2150564..2150926 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL036_RS11045 | 2150923..2151093 | - | 171 | WP_000948330.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EL036_RS11050 | 2151178..2152326 | - | 1149 | WP_001281141.1 | alanine racemase | - |
| EL036_RS11055 | 2152392..2152751 | - | 360 | WP_000581193.1 | holo-ACP synthase | - |
| EL036_RS11060 | 2152755..2153246 | - | 492 | WP_001205918.1 | PH domain-containing protein | - |
| EL036_RS11065 | 2153233..2154816 | - | 1584 | WP_001294624.1 | PH domain-containing protein | - |
| EL036_RS11070 | 2154809..2155288 | - | 480 | WP_001287080.1 | hypothetical protein | - |
| EL036_RS11075 | 2155497..2156057 | - | 561 | WP_001092400.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286984 WP_000621175.1 NZ_LR134193:c2150926-2150564 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|