Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1936018..1936794 | Replicon | chromosome |
Accession | NZ_LR134193 | ||
Organism | Staphylococcus aureus strain NCTC13616 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | EL036_RS09670 | Protein ID | WP_000031112.1 |
Coordinates | 1936018..1936170 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | EL036_RS09675 | Protein ID | WP_001251224.1 |
Coordinates | 1936195..1936794 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL036_RS09655 | 1931924..1932745 | + | 822 | WP_000669382.1 | RluA family pseudouridine synthase | - |
EL036_RS09660 | 1933207..1934592 | - | 1386 | WP_000116232.1 | class II fumarate hydratase | - |
EL036_RS09665 | 1934788..1935183 | - | 396 | WP_000901023.1 | hypothetical protein | - |
EL036_RS09670 | 1936018..1936170 | - | 153 | WP_000031112.1 | hypothetical protein | Toxin |
EL036_RS09675 | 1936195..1936794 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
EL036_RS09680 | 1936953..1937423 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
EL036_RS09685 | 1937428..1938555 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
EL036_RS09690 | 1938705..1939427 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
EL036_RS09695 | 1939420..1940877 | - | 1458 | WP_000649910.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5966.31 Da Isoelectric Point: 3.8962
>T286981 WP_000031112.1 NZ_LR134193:c1936170-1936018 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELSKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELSKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT286981 WP_001251224.1 NZ_LR134193:c1936794-1936195 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|