Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 832709..833186 Replicon chromosome
Accession NZ_LR134193
Organism Staphylococcus aureus strain NCTC13616

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag EL036_RS04025 Protein ID WP_000052076.1
Coordinates 832709..832897 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag EL036_RS04030 Protein ID WP_001059690.1
Coordinates 832926..833186 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL036_RS03995 828699..829220 + 522 WP_000824488.1 hypothetical protein -
EL036_RS04000 829561..830247 + 687 WP_001670297.1 thermonuclease family protein -
EL036_RS04005 830604..830804 + 201 WP_001059082.1 cold-shock protein -
EL036_RS04010 831300..831518 - 219 WP_000005876.1 hypothetical protein -
EL036_RS04015 831580..831864 - 285 WP_001004395.1 hypothetical protein -
EL036_RS04020 831952..832521 - 570 WP_001106646.1 hypothetical protein -
EL036_RS04025 832709..832897 - 189 WP_000052076.1 hypothetical protein Toxin
EL036_RS04030 832926..833186 - 261 WP_001059690.1 hypothetical protein Antitoxin
EL036_RS04035 833526..833729 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
EL036_RS04040 833726..833962 - 237 WP_000368687.1 hypothetical protein -
EL036_RS04045 834187..834768 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
EL036_RS04050 834841..835458 - 618 WP_000255559.1 LysE/ArgO family amino acid transporter -
EL036_RS04055 835612..836106 - 495 WP_000590539.1 GNAT family N-acetyltransferase -
EL036_RS04060 836505..836927 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
EL036_RS04065 837075..837791 + 717 WP_000150015.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286974 WP_000052076.1 NZ_LR134193:c832897-832709 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286974 WP_001059690.1 NZ_LR134193:c833186-832926 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References