Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2485878..2486533 | Replicon | chromosome |
| Accession | NZ_LR134189 | ||
| Organism | Providencia rustigianii strain NCTC6933 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL059_RS11525 | Protein ID | WP_071599550.1 |
| Coordinates | 2485878..2486063 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | D1P354 |
| Locus tag | EL059_RS11530 | Protein ID | WP_006814675.1 |
| Coordinates | 2486120..2486533 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL059_RS11505 | 2481791..2482879 | - | 1089 | WP_006814671.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
| EL059_RS11510 | 2482882..2483742 | - | 861 | WP_006814672.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
| EL059_RS11515 | 2483742..2484572 | - | 831 | WP_006814673.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
| EL059_RS11520 | 2484572..2485594 | - | 1023 | WP_006814674.1 | sulfate ABC transporter substrate-binding protein | - |
| EL059_RS11525 | 2485878..2486063 | + | 186 | WP_071599550.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL059_RS11530 | 2486120..2486533 | + | 414 | WP_006814675.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL059_RS11535 | 2486591..2487487 | - | 897 | WP_006814676.1 | Dyp-type peroxidase | - |
| EL059_RS11540 | 2487702..2488286 | - | 585 | WP_039855044.1 | RpoE-regulated lipoprotein | - |
| EL059_RS11545 | 2488368..2488799 | - | 432 | WP_006814678.1 | GNAT family acetyltransferase | - |
| EL059_RS11550 | 2488935..2489852 | + | 918 | WP_006814679.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| EL059_RS11555 | 2490010..2491143 | + | 1134 | WP_006814680.1 | M4 family metallopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7064.36 Da Isoelectric Point: 11.2336
>T286971 WP_071599550.1 NZ_LR134189:2485878-2486063 [Providencia rustigianii]
MKSSELIKLLEKNGWRLERIKGSHHQFSHPNFSIVITVPHPRKDLKIGTLNQILTVAKLKH
MKSSELIKLLEKNGWRLERIKGSHHQFSHPNFSIVITVPHPRKDLKIGTLNQILTVAKLKH
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15388.27 Da Isoelectric Point: 4.9767
>AT286971 WP_006814675.1 NZ_LR134189:2486120-2486533 [Providencia rustigianii]
MLYPAFIEIDSDGSASGWFPDIEGCTFAGDNIEDAYADAKSAIDVHFELLSEKGFKIPSPKSQHAHLQDTPDIYQKGIWL
LVDIDMDKYDGRAERVNITLPHRLLHRIDTLVKEHPEYGSRSGFIAAAARKELQKNS
MLYPAFIEIDSDGSASGWFPDIEGCTFAGDNIEDAYADAKSAIDVHFELLSEKGFKIPSPKSQHAHLQDTPDIYQKGIWL
LVDIDMDKYDGRAERVNITLPHRLLHRIDTLVKEHPEYGSRSGFIAAAARKELQKNS
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|