Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 875787..876430 | Replicon | chromosome |
| Accession | NZ_LR134189 | ||
| Organism | Providencia rustigianii strain NCTC6933 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D1P676 |
| Locus tag | EL059_RS03945 | Protein ID | WP_006815740.1 |
| Coordinates | 875787..875990 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | D1P675 |
| Locus tag | EL059_RS03950 | Protein ID | WP_006815739.1 |
| Coordinates | 876062..876430 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL059_RS03920 | 872049..872916 | - | 868 | Protein_762 | acyl-CoA thioesterase II | - |
| EL059_RS03925 | 873158..873400 | + | 243 | Protein_763 | endopeptidase | - |
| EL059_RS03930 | 873465..874978 | + | 1514 | WP_096746888.1 | IS3 family transposase | - |
| EL059_RS03935 | 875015..875233 | + | 219 | WP_126436404.1 | YbaY family lipoprotein | - |
| EL059_RS03945 | 875787..875990 | - | 204 | WP_006815740.1 | hemolysin expression modulator Hha | Toxin |
| EL059_RS03950 | 876062..876430 | - | 369 | WP_006815739.1 | Hha toxicity modulator TomB | Antitoxin |
| EL059_RS03955 | 876959..878335 | - | 1377 | WP_006815738.1 | murein transglycosylase D | - |
| EL059_RS03960 | 878419..879171 | - | 753 | WP_006815737.1 | hydroxyacylglutathione hydrolase | - |
| EL059_RS03965 | 879206..879931 | + | 726 | WP_006815736.1 | class I SAM-dependent methyltransferase | - |
| EL059_RS03970 | 879940..880411 | - | 472 | Protein_771 | ribonuclease HI | - |
| EL059_RS03975 | 880466..881227 | + | 762 | WP_006815734.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8087.38 Da Isoelectric Point: 6.9770
>T286966 WP_006815740.1 NZ_LR134189:c875990-875787 [Providencia rustigianii]
MTKSDYLMRLRKCTTLETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MTKSDYLMRLRKCTTLETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14120.98 Da Isoelectric Point: 4.3849
>AT286966 WP_006815739.1 NZ_LR134189:c876430-876062 [Providencia rustigianii]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTTTHWINDLSSPLSVSLNELVEHITSFVWRFKIKYPKENLVISLVEEYL
DETYDLFGSPVITFSEITDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTTTHWINDLSSPLSVSLNELVEHITSFVWRFKIKYPKENLVISLVEEYL
DETYDLFGSPVITFSEITDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A379G0S0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A379G117 |