Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2674845..2675382 | Replicon | chromosome |
Accession | NZ_LR134176 | ||
Organism | Legionella pneumophila strain NCTC12179 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL037_RS12060 | Protein ID | WP_027266055.1 |
Coordinates | 2674845..2675141 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | EL037_RS12065 | Protein ID | WP_027266056.1 |
Coordinates | 2675131..2675382 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL037_RS12030 (NCTC12179_02538) | 2670937..2671833 | - | 897 | WP_027266053.1 | hypothetical protein | - |
EL037_RS12035 (NCTC12179_02539) | 2672101..2672292 | + | 192 | WP_014327021.1 | hypothetical protein | - |
EL037_RS12040 | 2672441..2672545 | - | 105 | Protein_2393 | lytic murein transglycosylase | - |
EL037_RS12045 (NCTC12179_02540) | 2672763..2673302 | - | 540 | WP_062730332.1 | tetratricopeptide repeat protein | - |
EL037_RS12050 (NCTC12179_02541) | 2673262..2673915 | - | 654 | WP_027266054.1 | hypothetical protein | - |
EL037_RS12055 (NCTC12179_02542) | 2674274..2674756 | - | 483 | WP_014842908.1 | hypothetical protein | - |
EL037_RS12060 (NCTC12179_02543) | 2674845..2675141 | - | 297 | WP_027266055.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL037_RS12065 (NCTC12179_02544) | 2675131..2675382 | - | 252 | WP_027266056.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
EL037_RS12070 (NCTC12179_02545) | 2675546..2676751 | + | 1206 | WP_061638482.1 | ISNCY family transposase | - |
EL037_RS16670 | 2676924..2677124 | - | 201 | WP_027265577.1 | hypothetical protein | - |
EL037_RS12080 (NCTC12179_02546) | 2677702..2678841 | - | 1140 | WP_134984249.1 | DUF3800 domain-containing protein | - |
EL037_RS16675 | 2678959..2679066 | - | 108 | WP_229310140.1 | hypothetical protein | - |
EL037_RS16680 | 2679172..2679503 | - | 332 | Protein_2403 | recombinase family protein | - |
EL037_RS16200 | 2679591..2679731 | + | 141 | WP_154219844.1 | hypothetical protein | - |
EL037_RS12090 (NCTC12179_02549) | 2679756..2680259 | - | 504 | WP_027265579.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11512.36 Da Isoelectric Point: 10.3916
>T286961 WP_027266055.1 NZ_LR134176:c2675141-2674845 [Legionella pneumophila]
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASASLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYDDADNRQEDS
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASASLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYDDADNRQEDS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|