Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 1617916..1618450 | Replicon | chromosome |
| Accession | NZ_LR134171 | ||
| Organism | Haemophilus influenzae strain NCTC12699 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ELZ63_RS07990 | Protein ID | WP_065245132.1 |
| Coordinates | 1618160..1618450 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | E7A5Y2 |
| Locus tag | ELZ63_RS07985 | Protein ID | WP_005651514.1 |
| Coordinates | 1617916..1618170 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ63_RS07950 | 1613235..1613495 | + | 261 | WP_005663579.1 | hypothetical protein | - |
| ELZ63_RS07955 | 1613525..1613889 | + | 365 | Protein_1513 | DUF559 domain-containing protein | - |
| ELZ63_RS07960 | 1614513..1616579 | + | 2067 | WP_065245135.1 | glycine--tRNA ligase subunit beta | - |
| ELZ63_RS07970 | 1617078..1617386 | + | 309 | WP_065245134.1 | P2 family phage major capsid protein | - |
| ELZ63_RS07975 | 1617386..1617610 | + | 225 | WP_065245133.1 | hypothetical protein | - |
| ELZ63_RS07980 | 1617619..1617825 | + | 207 | WP_038440120.1 | hypothetical protein | - |
| ELZ63_RS07985 | 1617916..1618170 | + | 255 | WP_005651514.1 | stability protein StbD | Antitoxin |
| ELZ63_RS07990 | 1618160..1618450 | + | 291 | WP_065245132.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ELZ63_RS09350 | 1618886..1619023 | + | 138 | WP_164550136.1 | hypothetical protein | - |
| ELZ63_RS08000 | 1619493..1620527 | - | 1035 | WP_065245131.1 | DNA polymerase III subunit delta | - |
| ELZ63_RS08005 | 1620527..1621030 | - | 504 | WP_065245130.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11481.47 Da Isoelectric Point: 10.8143
>T286958 WP_065245132.1 NZ_LR134171:1618160-1618450 [Haemophilus influenzae]
MTYKLIFDKRALKEWNKLGKTLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
MTYKLIFDKRALKEWNKLGKTLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|