Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-DUF971
Location 1105409..1105998 Replicon chromosome
Accession NZ_LR134171
Organism Haemophilus influenzae strain NCTC12699

Toxin (Protein)


Gene name PumA Uniprot ID A0A852PKG5
Locus tag ELZ63_RS05350 Protein ID WP_005662099.1
Coordinates 1105409..1105708 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ELZ63_RS05355 Protein ID WP_005643896.1
Coordinates 1105705..1105998 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ63_RS05310 1101003..1101305 - 303 WP_065245332.1 hypothetical protein -
ELZ63_RS05315 1101242..1101790 - 549 WP_065245331.1 phage tail protein -
ELZ63_RS05320 1101868..1102380 - 513 WP_061724040.1 terminase small subunit -
ELZ63_RS05325 1102419..1102700 - 282 WP_065245330.1 hypothetical protein -
ELZ63_RS05330 1102612..1102928 - 317 Protein_1001 DUF2570 family protein -
ELZ63_RS05335 1102921..1103523 - 603 Protein_1002 glycoside hydrolase family 19 protein -
ELZ63_RS05340 1103492..1103848 - 357 WP_061724042.1 phage holin, lambda family -
ELZ63_RS09340 1103972..1104109 - 138 WP_015702297.1 hypothetical protein -
ELZ63_RS05345 1104184..1104831 - 648 WP_061724043.1 hypothetical protein -
ELZ63_RS05350 1105409..1105708 + 300 WP_005662099.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ELZ63_RS05355 1105705..1105998 + 294 WP_005643896.1 putative addiction module antidote protein Antitoxin
ELZ63_RS05360 1106029..1106400 - 372 WP_065245329.1 hypothetical protein -
ELZ63_RS05365 1106397..1106939 - 543 WP_061724044.1 recombination protein NinG -
ELZ63_RS05370 1107028..1107447 - 420 WP_065245328.1 recombination protein NinB -
ELZ63_RS05375 1107484..1107708 - 225 WP_005633909.1 hypothetical protein -
ELZ63_RS05380 1107705..1108340 - 636 WP_065245327.1 replication P -
ELZ63_RS05385 1108325..1109041 - 717 WP_061724046.1 helix-turn-helix domain-containing protein -
ELZ63_RS05390 1109038..1109658 - 621 WP_065245416.1 phage regulatory protein/antirepressor Ant -
ELZ63_RS05395 1109754..1110050 - 297 WP_061724047.1 hypothetical protein -
ELZ63_RS05400 1110071..1110277 - 207 WP_065245326.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1101003..1138193 37190


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-86)

Antitoxin

Uncharacterized protein HI1420

(3-95)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11197.10 Da        Isoelectric Point: 10.4328

>T286957 WP_005662099.1 NZ_LR134171:1105409-1105708 [Haemophilus influenzae]
MTIQIKTTLTFDSWLSKLKNLRAKAKINARIKRLQFGNFGDIKSVNDGIFELRIDEGQGYRIYLKNQNGVLVILLCGGDK
STQEKDIKQAKLLAQELGL

Download         Length: 300 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10889.38 Da        Isoelectric Point: 4.4488

>AT286957 WP_005643896.1 NZ_LR134171:1105705-1105998 [Haemophilus influenzae]
MTEQLKDFDVAEHLTSEEEIQLYLNEILQEDNIELILSALGDIARARNMSQIARDAGISREGLYKALSGTGNPTFATVMK
VMKALNLQFQVQQSRFA

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A852PKG5

Antitoxin

Source ID Structure

References