Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 12999..13603 | Replicon | chromosome |
| Accession | NZ_LR134171 | ||
| Organism | Haemophilus influenzae strain NCTC12699 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q4QMK7 |
| Locus tag | ELZ63_RS00055 | Protein ID | WP_011272186.1 |
| Coordinates | 12999..13307 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ELZ63_RS00060 | Protein ID | WP_065245463.1 |
| Coordinates | 13307..13603 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ63_RS00040 | 8759..8998 | - | 240 | WP_005651317.1 | hypothetical protein | - |
| ELZ63_RS00050 | 9751..12942 | + | 3192 | WP_126466918.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| ELZ63_RS00055 | 12999..13307 | - | 309 | WP_011272186.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| ELZ63_RS00060 | 13307..13603 | - | 297 | WP_065245463.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| ELZ63_RS00065 | 13723..14577 | - | 855 | WP_048954823.1 | DUF3298 domain-containing protein | - |
| ELZ63_RS00070 | 14596..16455 | - | 1860 | WP_065245464.1 | selenocysteine-specific translation elongation factor | - |
| ELZ63_RS00075 | 16452..17837 | - | 1386 | WP_065245465.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11929.69 Da Isoelectric Point: 7.8904
>T286955 WP_011272186.1 NZ_LR134171:c13307-12999 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGNLVLIYQYV
IHDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGNLVLIYQYV
IHDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|